KEGG   Prochlorococcus marinus NATL1A: NATL1_06521Help
Entry
NATL1_06521       CDS       T00467                                 

Gene name
glk
Definition
(GenBank) Putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00010  Glycolysis / Gluconeogenesis
pme00052  Galactose metabolism
pme00500  Starch and sucrose metabolism
pme00520  Amino sugar and nucleotide sugar metabolism
pme00521  Streptomycin biosynthesis
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01120  Microbial metabolism in diverse environments
pme01130  Biosynthesis of antibiotics
pme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NATL1_06521 (glk)
   00052 Galactose metabolism
    NATL1_06521 (glk)
   00500 Starch and sucrose metabolism
    NATL1_06521 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NATL1_06521 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NATL1_06521 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NATL1_06521 (glk)
Enzymes [BR:pme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NATL1_06521 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABM75214
CyanoBase: NATL1_06521
CYORF: NATL1_06521
UniProt: A2C154
Position
complement(597149..598192)
Genome map
AA seq 347 aa AA seqDB search
MNLLAGDLGGTKTILAIYSNENYPKKIFERYYISSEWKSFYSLFEDFIKHLPDHISLPQY
GSIGVAGPIQNQEVKITNLGWDIESKKLSLLSKINNIELINDFSVLIYGIPFFNRNQYEV
IQGTLNSDYKNDQKLIAIIGAGTGLGMSRGLITPKSISIFPSEGGHREFSPRTENEWALV
KWLKKKLNIQRISIERIVSGTGLGMIARWKLDDPINESHPLQVILKNMDSDKSDSTDLPA
LVWEKAKNGDKLMTEALQLWLNAYGSAAGDLALQELCSSGLWISGGTAAKNLDGINSSNF
LNAFSNKGRFQSYLKEIPLIVLKDPEATLFSSACRARLSAESNGRLS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacttgctggagaccttgggggaactaaaacaatattagctatttattcaaac
gagaactatccaaaaaaaatatttgagaggtactatatttcatcagaatggaaatctttt
tactcattatttgaagattttattaaacatttaccagatcatatatcactgcctcaatat
ggttctattggtgtagccgggccaatacagaatcaggaggttaagattacaaatcttggc
tgggatattgaatcaaaaaagttatctctactttcaaaaataaataatattgaattaata
aatgatttttcagttttaatctatggaataccattcttcaacagaaaccaatatgaagta
atacaagggacattaaattctgattacaaaaacgatcaaaaattaattgcaattattgga
gctggtactggcttaggaatgtccagaggcttgataacccctaaaagcatttctatattt
ccaagtgaaggagggcatcgagaattttccccaagaacagaaaacgaatgggcattagtc
aaatggctaaaaaagaagttaaatattcaaagaatatccattgaaagaattgttagtggt
actggccttggcatgattgccagatggaaattggatgatccaataaatgaaagccatcca
cttcaggtaattttaaaaaatatggatagtgacaaatcagattccacagatttacccgca
cttgtttgggaaaaagcaaaaaacggagacaaattaatgactgaagcattgcaactatgg
ctaaatgcttatgggtctgcagctggagaccttgctttacaagaactttgctcttcaggg
ttatggatttcaggtggaacagccgcaaaaaacctcgatggaataaactcttctaacttc
ctaaatgcatttagtaataagggtcgctttcaatcttatttaaaggaaatcccattgatt
gttcttaaagatccagaagcgacattattcagttcagcttgcagagcacgcttaagtgcc
gaatcaaatgggagacttagctaa

DBGET integrated database retrieval system