KEGG   Prochlorococcus marinus NATL1A: NATL1_15321Help
Entry
NATL1_15321       CDS       T00467                                 

Gene name
chlI
Definition
(GenBank) Protoporphyrin IX Magnesium chelatase, ChlI subunit
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00860  Porphyrin and chlorophyll metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NATL1_15321 (chlI)
Enzymes [BR:pme01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     NATL1_15321 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA AAA_18 DUF815 ABC_tran AAA_30 AAA_28 AAA_33 SHS2_FTSA MMR_HSR1 AAA_14
Motif
Other DBs
NCBI-ProteinID: ABM76089
CyanoBase: NATL1_15321
CYORF: NATL1_15321
UniProt: A2C3M9
Position
1246890..1247978
Genome map
AA seq 362 aa AA seqDB search
MSSTRKRRVFPFTSVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPA
IEVVEGDPYNSSLEDPDLQSNDVRERIDSGSEIQKGEKQVPMIDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVREAKLRVQVVDQRTAFDNDPESFSDS
VQEKQESLQQKVVDAQNILNEVIIDEDLRLRISAVCGELDVDGLRGDIVTNRAARALAAF
EGRKEVTEEDIARVVSTALRHRLRKDPLEQVDSGDRVIKAFCKVFERNESDDVSEFELAT
AN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaacaagaaaacgcagagtttttccattcacttcagtgattggacaagaggaa
atgaagctagcgcttctcttaaatgtaattgaccctagaattggcggagtaatgataatg
ggtgatagaggcacgggaaagtccacaaccataagagcacttgcagatctattacctgca
attgaagtcgttgaaggagatccatacaacagctctcttgaggatccagaccttcaaagt
aatgatgtcagagagagaatagacagtggtagtgagattcaaaaaggtgaaaaacaagtt
ccgatgattgatctacccctaggtgccactgaggatagactttgcggaactattgatatc
gaaaaggcccttagtgagggagttagagcttttgagccaggactgctcgccaaagcaaac
agagggttgctttatgttgatgaagtcaacttgctagatgatcaccttgttgacgtactt
ttagactctgcggcatcaggctggaatacagttgaaagagaaggtatttcggttcgacat
cctgcaaggtttgtacttattggttcaggaaatcctgaggaaggagagttaaggcctcag
ttacttgatcgttttgggatgagtgtagaagtaagaacagtaagggaggcaaaactacga
gttcaagtcgttgatcaacgtacagcttttgataatgatcctgaatcttttagcgattca
gttcaggaaaaacaagaatcacttcaacaaaaagttgttgatgctcaaaatatacttaac
gaggttattatcgatgaagatctcagactaaggatttcagcagtttgtggtgaacttgat
gttgatggacttagaggggatattgtaacgaatagagcagctagagcccttgctgcattt
gaagggagaaaagaagtaaccgaagaagatattgctcgtgtcgtgtctacagccttaagg
cataggcttcgaaaagatcctcttgaacaagttgattctggagatagagtaataaaagct
ttttgcaaagtatttgaaaggaatgaaagtgatgacgtatctgaattcgaactagccacc
gctaactaa

DBGET integrated database retrieval system