KEGG   Prochlorococcus marinus NATL1A: NATL1_16121Help
Entry
NATL1_16121       CDS       T00467                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase CobB
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00860  Porphyrin and chlorophyll metabolism
pme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NATL1_16121 (cobQ)
Enzymes [BR:pme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     NATL1_16121 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO GATase DJ-1_PfpI BPL_N GATase_5
Motif
Other DBs
NCBI-ProteinID: ABM76169
CyanoBase: NATL1_16121
CYORF: NATL1_16121
UniProt: A2C3V9
Position
1317516..1319000
Genome map
AA seq 494 aa AA seqDB search
MVLGTSSGAGKTLIATAICRCLRRKGEQPIPFKGQNMSNNAWVDTQGREMAYSQALQSWS
AGLEPSAEMNPVLLKPKGDCTSEVIHLGKSVGTSKAINYYEDWFDSGWEAIKKGLAILLK
SKIDGRLILEGAGSPVEVNLQHKDLTNLKLAKFLNANCILVADIERGGVFAQIIGTIALM
KPDEKKLIKGIIINRFRGDKALFESGVTWIEKETGIPVLGILPWLKEIFPPEDSLDLLER
KQVNKSAEIEIAIIKLPRISNFSDLDPFFSDSSIQMRWIEPGQDLGNPDVLIIPGSKQTI
KDLESLNKTGLSNQIKNYAKKGGNIFGICGGLQMLGKTLEDPHKQESIKEQNTFSNMGMN
LLPIKTTFGEIKHTSQREEKVSWPVSQSLKGFEMHYGESDLINNTDSEIISLFKNSSLGW
VIEKKDKSFVGGTYLHGIFENDEWRRQWINKIRQKKGLNHLKIDKENNNDKRERLLDLLT
DAFEKNINIDILIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttttaggaacctcaagtggcgcaggtaaaacactcatagctactgctatttgtcga
tgcttaagaaggaaaggggaacagccaataccttttaagggccaaaacatgagcaataac
gcttgggttgatacccagggaagagaaatggcatattctcaagcccttcaatcttggtct
gcaggcttagagccaagtgctgaaatgaatcctgtacttctaaagccaaaaggggattgc
acaagtgaagtaattcatctaggcaaaagtgtcggcactagcaaagcgatcaattattac
gaagactggtttgattcagggtgggaagctattaaaaaaggcctagcaatattattaaag
agtaaaatcgacggaagactgattcttgaaggggccggaagcccagtagaagtgaatttg
caacataaagatcttacaaatttgaaattagcaaaatttctaaatgcaaattgtatttta
gtagcagatattgaaaggggaggagtttttgctcaaatcattggaacaattgcattgatg
aaacctgatgaaaaaaaattaattaaaggaataattattaatagattcagaggcgataaa
gccttattcgaatcaggagtcacatggatagaaaaagaaacaggaatcccagttttagga
atattaccgtggctaaaagagatttttccacctgaagattcccttgacttacttgaaagg
aaacaagtaaataaaagtgcagaaatagaaatagcaataataaaattacctaggattagc
aatttttctgatttagatcctttctttagcgattcaagtattcaaatgcgatggatagaa
cccggacaagacctaggtaatccagatgtattaataattcctggaagcaaacaaacaatt
aaagatttagaaagtctaaataaaactggtttgagcaatcaaataaaaaattatgcaaaa
aaagggggaaatatttttggcatatgtggagggttacaaatgctaggaaaaacattggaa
gaccctcacaagcaagaaagtatcaaggagcaaaatacattttcaaatatggggatgaat
cttcttccaatcaaaacaacttttggagaaatcaagcacacctcacaaagagaagaaaaa
gtttcatggccagtttctcagagtctaaaggggtttgaaatgcattatggggaaagtgat
ttgatcaataatacagattccgaaattatttctctatttaaaaacagttctttagggtgg
gtaatagaaaaaaaagataaaagctttgttgggggaacttatttacatggaatttttgaa
aatgatgaatggcgaaggcaatggatcaataaaataagacagaaaaagggattaaatcat
ttaaaaattgataaagaaaacaataatgataaaagagaaagattattagatttattaact
gatgccttcgaaaaaaatataaatatagatattttaatcaaataa

DBGET integrated database retrieval system