KEGG   Prochlorococcus marinus NATL1A: NATL1_20451Help
Entry
NATL1_20451       CDS       T00467                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00020  Citrate cycle (TCA cycle)
pme00480  Glutathione metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01120  Microbial metabolism in diverse environments
pme01130  Biosynthesis of antibiotics
pme01200  Carbon metabolism
pme01210  2-Oxocarboxylic acid metabolism
pme01230  Biosynthesis of amino acids
Module
pme_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NATL1_20451 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NATL1_20451 (icd)
Enzymes [BR:pme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NATL1_20451 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABM76601
CyanoBase: NATL1_20451
CYORF: NATL1_20451
UniProt: A2C541
Position
1687498..1688922
Genome map
AA seq 474 aa AA seqDB search
MANFEKLTAPSEGQRITFSDGNPVVPDHPIIPFIRGDGTGIDIWPATQLVIDKAIEKAYG
KNRSIEWFKIYAGDEACELYGTYQYLPNDTLEAIRTYGIAIKGPLTTPVGGGIRSLNVSL
RQIFDLYSCVRPCKYYEGTPSPHKKPQDLDVIVYRENTEDIYMGIEWESDDPECIKLIDQ
INNEIIPASQKLKNRKIPSGSGIGIKPVSKSGSQRHIRRAIKHALTLEGSKRHVTLVHKG
NIMKFTEGAFRDWGYELATTEFRNECVTERESWILDNVEKNPHISYEENAELIDPGYSSL
TEEKKKAICDEVCSVLSIIGSSHGSGKWKDMVMVDDRIADSIFQQIQTRPQEYSILATLN
LNGDYISDAAAAIVGGLGMAPGANIGDKAAIFEATHGTAPKHAGLDRINPGSVILSGVMM
LEYLGWNEAAKLITNGLSKSISDKQVTYDLARLMEPRVEPLSCSDFANSIVERF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattttgaaaagcttactgcaccatcagaaggccaaagaattactttttctgat
gggaacccagtagtcccagaccatccaattattccatttatcagaggtgatggaacaggg
attgatatttggccagctacacaattagtcatcgataaagctattgaaaaagcttatgga
aaaaatcgatccattgaatggttcaaaatctatgcaggtgatgaagcttgcgagttatac
ggaacttatcaatatttaccaaacgataccctcgaagcgatccgaacttacgggatagct
atcaaaggacctttaacaactcctgtaggtggtgggattagatctttaaacgtatctcta
agacagatttttgatctatattcatgtgttaggccttgcaaatattacgaagggactcca
agccctcataaaaagcctcaggatttagatgtaattgtttatagagaaaatactgaagat
atttatatgggtattgaatgggaatctgatgatcctgaatgcatcaaattgattgaccaa
atcaataatgaaataattccagccagccaaaaactaaaaaacaggaaaattccaagcgga
tcaggaataggcattaaaccagttagtaaaagtggtagtcaaagacatatcagacgtgca
attaaacatgcactcaccctggaagggagcaaaagacatgtgaccttggttcacaaggga
aacatcatgaaattcactgaaggagctttcagagattggggatacgaattagcaaccaca
gaatttaggaatgaatgcgttaccgagagagaaagttggattttagataatgtagaaaaa
aatcctcatatctcctatgaggagaatgctgagttaattgatccaggttattcgtcttta
acagaagagaaaaagaaagctatttgtgatgaggtttgttccgttctttcaatcattggc
agtagtcatggcagtggtaaatggaaagatatggtgatggttgatgaccgaatagcagat
agtatttttcaacaaattcaaactcgtcctcaagagtattccatacttgcaactctcaat
cttaatggtgactacatatcggatgcggccgctgcaattgttggtggactggggatggca
ccaggtgcaaacattggagataaagcggctattttcgaagccacccatggaacagctcct
aaacatgcaggtttggacagaataaatccaggttcagtaatactaagtggagtaatgatg
ctggaatatttgggttggaatgaggcagcaaaattaattacaaatggattgagcaaatct
atttcagacaaacaagttacttacgatctagcacgattaatggaaccacgcgtagagcct
cttagttgtagtgattttgcgaactcaattgttgaaagattttaa

DBGET integrated database retrieval system