KEGG   Prochlorococcus marinus NATL1A: NATL1_20711Help
Entry
NATL1_20711       CDS       T00467                                 

Definition
(GenBank) two-component response regulator
Organism
pme  Prochlorococcus marinus NATL1A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABM76627
CyanoBase: NATL1_20711
CYORF: NATL1_20711
UniProt: A2C567
Position
complement(1715525..1716265)
Genome map
AA seq 246 aa AA seqDB search
MTCILVVDDEPAVLKVLVTRLNLAGYQVLSAQDGEQALEVFHKEAPDLVVLDVMLPKMDG
FAVCRRIRAESCVPIIFLTALEAISERVAGLDLGADDYLAKPFSPKELEARIATILRRVG
PAPTIDEPREVPSGQGVMKLGDLVVDTNRRQVSRGGERIGLTYTEFSLLELLFRDPGRVV
PRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEPDPRNPELILTVRGIGYASQRIGEF
PTAIAS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctgcattttggttgtagatgatgaaccagcagtattgaaagtcttggtaacgagg
ctaaatcttgctggttatcaagttttatctgcacaggatggagagcaagcactagaggtt
tttcacaaagaagctccagacttagtggttctagatgtcatgctccctaagatggatggc
tttgcagtttgtcgaagaattagagctgagtcttgcgttccaataatattcttgactgct
cttgaagcgatttcagaaagagtagcaggtttggatttaggcgctgatgattacctggct
aaaccatttagccccaaggagttagaagctagaatagcgacgattttgagacgagtggga
cctgctccaactattgatgaaccaagagaagtcccgtcaggtcaaggagtaatgaagctt
ggtgatcttgttgtagacaccaatagaaggcaagtcagtagaggaggagaaaggataggc
ttaacatatacagaatttagcttgctggaattattatttcgtgatcctggccgtgttgta
cctcgagcagaaattctggaacagctttggggttatcctccaagaagagcggcggattta
agagttgtagatgtctacgtagctcgtttaagagggaagcttgaaccagatcctaggaat
cctgagttgattttgactgtcagaggtattggctacgcttctcaaagaattggagaattt
cctactgctattgccagttaa

DBGET integrated database retrieval system