KEGG   Prochlorococcus marinus NATL1A: NATL1_20841Help
Entry
NATL1_20841       CDS       T00467                                 

Gene name
btuE
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00480  Glutathione metabolism
pme00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NATL1_20841 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NATL1_20841 (btuE)
Enzymes [BR:pme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NATL1_20841 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABM76640
CyanoBase: NATL1_20841
CYORF: NATL1_20841
UniProt: A2C580
Position
1727688..1728164
Genome map
AA seq 158 aa AA seqDB search
MSVNISKVEVFSFKNQKITFDHYKGNVLLIVNVASKCGFTKQYKALQYLQDKYESKGFKV
LGFPCNDFGNQEPGQLEEIKEFCSTTYGVTFQLFQKVHAKGKTTEPFTTLNQLSPSGDVE
WNFEKFLINTEGDAVLRFKSSIEPDSPEITQAIEKLLD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaaatatcagcaaagtggaggtcttctcttttaaaaatcagaaaataactttt
gatcattacaaaggaaatgtcttattgattgtcaatgtcgcaagcaagtgcgggtttact
aagcaatataaagctcttcagtatcttcaggataaatatgaatccaaaggcttcaaagtt
ttaggctttccttgtaatgactttggaaaccaagagcctgggcaattagaagaaataaaa
gagttctgttcaacaacttatggagtaactttccaacttttccaaaaagttcatgccaaa
ggcaaaacaacagaaccatttactactttgaatcaattaagtccatccggagacgttgaa
tggaactttgagaaatttctcattaatactgagggagatgcggtcttaagatttaaaagt
tcaatagaacctgacagtcctgaaatcacacaagcaatcgaaaaattactcgattaa

DBGET integrated database retrieval system