KEGG   Prochlorococcus marinus NATL1A: NATL1_21571Help
Entry
NATL1_21571       CDS       T00467                                 

Definition
(GenBank) MazG family protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00230  Purine metabolism
pme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NATL1_21571
Enzymes [BR:pme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     NATL1_21571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MazG PRA-PH TFA2_Winged_2 Interferon DUF4363 Urm1 DUF2610 PTPlike_phytase LPD11 KELK
Motif
Other DBs
NCBI-ProteinID: ABM76713
CyanoBase: NATL1_21571
CYORF: NATL1_21571
UniProt: A2C5F3
Position
1814148..1814960
Genome map
AA seq 270 aa AA seqDB search
MTNTNQINTKDKLNKLLEVVSDLRDPINGCPWDLKQTHLSLVPYVLEEAYEVAHAIREDN
PDELKEELGDLLLQVILHAQIAKEKNLFDITDIIDMITEKLIRRHPHVFQNKAKVSIKEV
EDSWETIKNNEKPLNNSKTPISDRLKLKIRPQPSTKAALIISKKASKNGFEWENIDQIWD
KLHEELEELKDALKKENTAEAEAEIGDVLFTLINIARWNKISLEDGLAKTNKKFLERLTY
IEENIDGELHSQSKKKLEKYWKLAKINLKH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacacaaaccaaataaatacaaaagataaactgaataaactccttgaagtagtt
tcagacctaagagatccaatcaatggctgtccttgggacctaaagcaaacgcatctttct
ttggtcccatatgttctagaagaagcctatgaagttgctcacgcaataagagaagacaat
cctgatgaattaaaagaggagcttggagatctcttactacaagtaattttgcatgctcaa
atagcaaaagaaaaaaacttatttgacataacagacatcattgacatgatcactgaaaaa
ctaattcgaaggcatccacatgtatttcagaataaagcaaaagtaagcatcaaagaagtg
gaagactcttgggaaacaatcaagaataatgaaaaaccattaaataattcaaaaacccca
attagtgaccgattaaaactaaagataaggccacaaccttctacgaaagcagcactaatt
atctccaaaaaagcttcaaaaaacggatttgaatgggaaaacattgatcaaatctgggat
aaattacatgaagaattagaagaattaaaagatgcattaaaaaaagaaaatactgccgaa
gctgaagctgaaataggagacgtattatttacattgataaatattgcaagatggaataaa
atttccttagaagatgggttagcaaaaactaataaaaaattcctagaacgattaacatat
atagaagaaaatatagatggcgaattacattcccaatcaaaaaagaaattagaaaaatat
tggaaattagcgaagatcaatctcaagcattaa

DBGET integrated database retrieval system