KEGG   Prochlorococcus marinus NATL1A: NATL1_21581Help
Entry
NATL1_21581       CDS       T00467                                 

Gene name
speE
Definition
(GenBank) putative spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00270  Cysteine and methionine metabolism
pme00330  Arginine and proline metabolism
pme00480  Glutathione metabolism
pme01100  Metabolic pathways
Module
pme_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NATL1_21581 (speE)
   00330 Arginine and proline metabolism
    NATL1_21581 (speE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NATL1_21581 (speE)
Enzymes [BR:pme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     NATL1_21581 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_12 Methyltransf_25 MTS Methyltransf_PK Methyltransf_11 Methyltransf_30 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ABM76714
CyanoBase: NATL1_21581
CYORF: NATL1_21581
UniProt: A2C5F4
Position
1814971..1815837
Genome map
AA seq 288 aa AA seqDB search
MNYKLKTRSGWLDEYHQGVRYGLEGKLILEESSPFQKITIYESKRYGKALLLDDCWMTAE
KSEKCYHECLIHPALCCSTRIDNILIIGGGDGGSARECLKYKEVKSIDLVEIDLRVIELS
QKYLPTIGGNAWSDSRLNLQIKNGIDWVKHTKENSYDVIIIDGADPIGPSKELFSNSFLK
DCKRILKPGGVLATQSESPESFQEIHINIVKILREIFDYADPMYGSVSIYPSGLWSWAFA
SMENPKYIYPKKSRVKEISENCQVWSERWQQGAFNTIPAFIERELAKI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaactaaaaacaaggtcagggtggcttgacgagtatcatcaaggcgttaga
tatggactagagggaaaattaatactagaagagtctagcccttttcaaaaaattaccata
tatgaaagtaaaagatatgggaaagcactattacttgatgattgctggatgactgcagaa
aagtctgaaaagtgttatcacgaatgtcttattcaccctgccttgtgttgttctacacga
atagataatattttaattattggaggaggtgatgggggtagtgcaagagaatgtttaaaa
tacaaagaggttaagtctatcgatttagttgaaattgatctaagagttattgaattaagt
caaaaatatttacctactattggaggaaatgcatggtctgattcacgattaaatttacaa
atcaaaaatggaattgattgggtaaagcatacaaaagagaattcatatgatgtaattatt
attgatggagcagatcctattggaccgtccaaagaattattcagcaattcttttctgaaa
gattgcaaacgaatacttaaaccaggaggggttttggcaacacaaagtgaatctccagag
tcttttcaagaaattcacataaatattgtcaaaattcttcgtgaaatttttgactacgct
gatccaatgtatggatctgtatccatatacccaagcggtttatggagctgggcatttgca
tctatggagaatccaaaatatatatatccaaaaaaaagtcgcgtaaaagagatctccgaa
aattgtcaggtttggagtgagcgatggcaacaaggtgcttttaacactattcctgcattt
atagaaagggagctagcaaaaatatga

DBGET integrated database retrieval system