KEGG   Prochlorococcus marinus NATL1A: NATL1_21601Help
Entry
NATL1_21601       CDS       T00467                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
pme  Prochlorococcus marinus NATL1A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM76716
CyanoBase: NATL1_21601
CYORF: NATL1_21601
UniProt: A2C5F6
Position
complement(1816753..1816968)
Genome map
AA seq 71 aa AA seqDB search
MTTKRCCRSCNQCVSSHFDSFSWCKLRKIKIHSEISSFVSCGHWIKKEPNFPKISEKFVH
QQLDFGKVLVE
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaaaagatgttgtaggagctgcaatcaatgtgtttcaagtcattttgattca
ttctcatggtgcaaacttagaaaaataaaaatacattctgagatatcttcatttgtttct
tgtggtcattggataaaaaaagaacctaatttcccaaagatttctgaaaaatttgttcat
caacaacttgattttggaaaggtattagttgaatga

DBGET integrated database retrieval system