KEGG   Prochlorococcus marinus NATL1A: NATL1_21611Help
Entry
NATL1_21611       CDS       T00467                                 

Gene name
gcvT
Definition
(GenBank) putative Glycine cleavage T-protein (aminomethyl transferase)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00260  Glycine, serine and threonine metabolism
pme00630  Glyoxylate and dicarboxylate metabolism
pme00670  One carbon pool by folate
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01130  Biosynthesis of antibiotics
pme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NATL1_21611 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NATL1_21611 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NATL1_21611 (gcvT)
Enzymes [BR:pme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     NATL1_21611 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: ABM76717
CyanoBase: NATL1_21611
CYORF: NATL1_21611
UniProt: A2C5F7
Position
1817099..1818217
Genome map
AA seq 372 aa AA seqDB search
MKLLQTPLYQECKELGGKMVPFANWEMPVSFSGLIEEHNAVRKNVGMFDISHMGVVQLKG
KNIKSALQNLVPSDVFRIGPSEACYTVFLKENGGIQDDLIIYDQGVLDTNEESVVLVINA
ARKESDVEWLSSNLSKKEITISEFMPEGALIAIQGPESISTLEKILEEPLSNLPRFGHRT
ITSNPNLINSQESIFIARTGYTGEEGFEFLSSPETAKSIWKSLIASGVTPCGLGARDTLR
LEASMHLYGNDINLDTTPFEAGLGWLVHLEMPNDFIGRKALEKQAEVGTQKKLVGIQVLD
KGIARKGYPVLYNSETVGIVTSGTWSPTLQKPIALAYVPSEIAKVNTQIEVEIRGKKHPA
IIVKRPFYRKGF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaattactacaaactcctctttatcaagaatgcaaagaattaggcggtaaaatggtc
ccttttgcaaattgggaaatgcctgttagtttttctgggttaatagaagaacacaatgca
gtaagaaaaaatgttggaatgttcgacatatctcacatgggtgttgtgcaattaaaaggt
aaaaatatcaaaagcgcattacaaaatttagttccctcagacgtgtttcggataggacct
agtgaagcgtgttatacagtttttttaaaagagaatggaggaattcaagacgatctaatc
atttatgaccaaggagttttagatacaaatgaagagagtgtagttctagttattaatgcg
gcaagaaaagaatctgacgttgaatggttgagttcaaatctttctaaaaaggaaatcaca
atatccgaattcatgccagagggtgcattaattgcgatccaaggtccagaatctatcagt
acacttgagaaaattctcgaagagcctttatctaatttgccacgttttggtcacagaact
atcacttcaaatcccaatctaataaactcacaagaatcaatttttattgcacgaactggt
tatacaggagaggaaggtttcgaattcttgtcatctcctgaaacagcaaagtctatctgg
aagagtctaattgcgtcgggagttactccatgcgggctaggagcaagagatacactgcgg
ttagaggcttctatgcatttatatggcaacgatatcaacctagatacaactccctttgaa
gctggcttgggttggttagttcatttagaaatgcctaatgatttcataggtaggaaagct
ctagaaaaacaagccgaagttggaacgcaaaaaaaacttgttggtattcaagtccttgat
aaaggaattgcaagaaaaggatatccagttctatacaacagcgaaactgtaggaatagtc
actagcggaacatggtctccaacattgcaaaaacccatagctcttgcttatgtgccaagc
gaaattgcaaaagtcaatactcaaatagaagtagaaattagaggaaaaaaacatcctgca
ataatcgtaaaaagaccattctatcgaaaaggtttttga

DBGET integrated database retrieval system