KEGG   Prochlorococcus marinus NATL1A: NATL1_21631Help
Entry
NATL1_21631       CDS       T00467                                 

Gene name
pyrG
Definition
(GenBank) Glutamine amidotransferase class-I:CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00240  Pyrimidine metabolism
pme01100  Metabolic pathways
Module
pme_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NATL1_21631 (pyrG)
Enzymes [BR:pme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     NATL1_21631 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Motif
Other DBs
NCBI-ProteinID: ABM76719
CyanoBase: NATL1_21631
CYORF: NATL1_21631
UniProt: A2C5F9
Position
1820216..1821883
Genome map
AA seq 555 aa AA seqDB search
MAKFVFVTGGVVSSIGKGIVAASLGRLLKSKGYSVSILKLDPYLNVDPGTMSPFQHGEVF
VTEDGAETDLDLGHYERFTDTAMSRLNSVTTGSIYQAVINKERRGDYDGRTVQVIPHITR
EIRERIKRVANNSGADVVISEIGGTVGDIESLPFLEAIREFKGDVKRNDVVYVHVTLLPY
IGTSGEIKTKPTQHSVKELRSIGIQPDILVCRSDRPINDELKNKIGGFCGVNSEAVIASL
DADSIYSVPLALKDEGLCKEVLDCLDLNDHESDLKDWERLVHKLRNPGPSVKVALVGKYV
QLNDAYLSVVEALRHACISHDASLDLHWINAENIESEGAEKLLQGMDAIVVPGGFGNRGV
NGKIAAIRWAREQRVPFLGLCLGMQCAVIEWARNIAGLEDASSAELNPNSKHPVIHLLPE
QQDVVDLGGTMRLGVYPCRLQANTTGQSLYNEEVVYERHRHRYEFNNSYRTLLMESGYVI
SGTSPDGRLVELIELKNHPFFIACQYHPEFLSRPGKPHPLFGGLIQAAQIRVPSSPSEAF
NPQSKIIEKKSLEQQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgttttcgtcactggtggtgtagtttcaagcattggcaaaggaattgtt
gccgcaagtcttggcagactacttaaatcaaaagggtacagtgtttcgattttgaagctt
gacccatatttaaatgttgatcctgggacgatgagcccatttcaacatggagaagttttt
gtaactgaagacggggctgaaactgatttggaccttgggcattatgagcgctttacagac
actgcaatgtcaagactaaacagtgtcacgacaggttccatttatcaagctgttattaat
aaagaaagaagaggtgactatgacggaaggacggttcaagtaatcccccacatcactcgt
gaaattcgcgaaagaattaaacgtgtagcaaacaatagtggtgcagatgtagtgatatca
gaaattggaggaacagttggagatattgaatctctaccttttcttgaagcaataagagaa
tttaaaggagatgtaaaaagaaacgatgttgtttatgttcacgtcacattattgccttac
ataggtacatctggagaaattaaaaccaagccaacacagcactcagtaaaagaattgcgt
tctataggtattcagccagatattttagtttgtcgcagtgataggcctattaatgatgaa
ttaaaaaataaaatagggggtttctgtggagttaactctgaagcggtcatagcatcctta
gatgctgacagtatttactcagtaccattagcgctcaaagatgagggactttgcaaggaa
gtattagattgcttggatctaaatgatcatgaaagtgatttaaaagactgggaacgatta
gtccataaattgcgcaatccaggtccttctgtcaaagttgcattagttggcaaatatgta
caattaaatgatgcctacttatcagtagtcgaagcattacgtcacgcatgtatctcgcat
gatgcgtctttagatcttcactggatcaatgcggaaaacatagaatccgagggagctgaa
aaactactgcagggaatggacgcaattgtcgttccaggaggttttggtaaccgtggcgtc
aatgggaaaatagctgctattagatgggcaagggagcaaagagtaccttttttagggctt
tgcttaggtatgcaatgtgctgtcattgaatgggctcgcaatatcgctggtttagaagat
gcatctagtgccgaactaaatccgaattcaaaacacccagtaattcacttacttccagaa
caacaagacgtcgttgatctaggaggaacaatgagattaggcgtatatccttgtagactt
caagcaaacacaacaggacaaagtttatacaacgaagaagttgtttacgaaaggcataga
catcgttatgaattcaataattcatacagaactctactaatggaatctgggtatgtaatt
agtggtacttcacctgatggtcgattagtagagttaatagaattaaaaaatcacccattt
tttattgcatgtcaatatcatccagaattcctctctagaccaggaaaaccacacccttta
tttggtggtttgattcaagccgcacaaatacgtgtaccatcctcaccgagtgaggcattt
aatcctcaatcaaaaattattgaaaaaaaatcactagaacagcaatag

DBGET integrated database retrieval system