KEGG   Prochlorococcus marinus NATL1A: NATL1_21641Help
Entry
NATL1_21641       CDS       T00467                                 

Gene name
nrdG
Definition
(GenBank) possible organic radical activating enzyme
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00790  Folate biosynthesis
pme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NATL1_21641 (nrdG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pme03016]
    NATL1_21641 (nrdG)
Enzymes [BR:pme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     NATL1_21641 (nrdG)
Transfer RNA biogenesis [BR:pme03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    NATL1_21641 (nrdG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_14 Radical_SAM Fer4_12
Motif
Other DBs
NCBI-ProteinID: ABM76720
CyanoBase: NATL1_21641
CYORF: NATL1_21641
UniProt: A2C5G0
Position
1821884..1822525
Genome map
AA seq 213 aa AA seqDB search
MGSSLPVVECFHSLQGEGEHAGRSAYFIRLASCKVGCPWCDTKDSWNSELHPQQSLIDLS
TQTAKAQEEGAAFVVITGGEPLHHNLDDLCKEIRKSTLNLEKKSIPIHLETSGVDMLSGK
PDWITLSPKRHSPPRLDNLLSCQELKVVIQNAEDLVFAKTMADSIKNNGKIKPQLFLQAG
WENEEGQTLAIKFVKNNPDWRLSMQTHKWLGVL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggatcttctctaccagtagttgaatgttttcattctctacaaggagaaggagaacat
gcaggtagaagcgcttacttcatcagattggctagttgtaaagttggatgtccttggtgt
gatacaaaagattcgtggaattcagaacttcatccacaacaaagcttgatagatttatca
actcaaacagccaaagcccaagaagaaggtgcagcctttgttgtaatcacgggaggcgag
ccattacatcataatttagatgatctctgtaaagaaattagaaaatctacactcaatcta
gagaaaaaatctattccaattcatctcgaaactagtggagtagatatgctaagtggcaag
cccgattggataacattatctcctaaacggcattctcctccacgccttgataatctctta
tcttgccaagaattaaaagttgttatccagaatgctgaagatttagtttttgctaaaaca
atggctgattcaataaaaaataatggaaaaattaaacctcaattatttttgcaagcagga
tgggaaaatgaagagggacaaacacttgcaatcaagtttgtcaaaaataatccggattgg
agattaagtatgcaaactcacaaatggctaggtgtactctaa

DBGET integrated database retrieval system