KEGG   Prochlorococcus marinus NATL1A: NATL1_21651Help
Entry
NATL1_21651       CDS       T00467                                 

Definition
(GenBank) hypothetical ATPase
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00790  Folate biosynthesis
pme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NATL1_21651
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pme03016]
    NATL1_21651
Enzymes [BR:pme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     NATL1_21651
Transfer RNA biogenesis [BR:pme03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    NATL1_21651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC NAD_synthase Asn_synthase ThiI tRNA_Me_trans Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ABM76721
CyanoBase: NATL1_21651
CYORF: NATL1_21651
UniProt: A2C5G1
Position
1822575..1823252
Genome map
AA seq 225 aa AA seqDB search
MIEQTTIALLSGGIDSATAACIAMEAGQKVIGLSFDYGQRHLKELQAAADLAKNLNLEDH
ITIKIDLSSWGGSSLTDTSQAIPTKGIQKNTIPNTYVPGRNTIFVAIGLSLAEARGANRI
ALGINAMDYSGYPDCRPDYLKAYQELANLSSRVGREGKGIKLWAPLLDWEKTKIFEEALR
LKIPIEKTWSCYQGESKPCGRCDSCRIRDKALKEIGREDLCSQNI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagacaacaattgcattactttctggaggaattgattcagctacagctgca
tgtatcgctatggaagctgggcaaaaagtaattggattatcatttgattatggccagcga
catcttaaggagttacaagcagcagcagatttagcaaaaaatttaaatcttgaggatcat
ataacaataaagattgatttatcttcttggggtggttcctccttgaccgacacgtcacaa
gcaataccaactaaaggcatacaaaaaaatactattcctaacacttacgttcctggtaga
aacactatctttgttgctattggtttgagtcttgcagaagcacgtggagccaatcgaatc
gcattaggaataaatgcaatggactattctggatatccagactgtagaccggattattta
aaagcatatcaagaattagctaacctatcgagcagagtaggacgcgagggaaaagggata
aaactatgggctccactactagattgggaaaaaacaaaaatctttgaggaggcattacgc
ttaaaaattcctatagaaaaaacatggagttgctatcaaggtgaaagtaaaccgtgtggg
agatgtgatagttgtcgtattagagataaagcattaaaagaaataggtcgcgaagatcta
tgtagtcaaaatatctag

DBGET integrated database retrieval system