KEGG   Prochlorococcus marinus NATL1A: NATL1_21661Help
Entry
NATL1_21661       CDS       T00467                                 

Definition
(GenBank) possible p-aminobenzoate synthetase
  KO
K01665  para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NATL1_21661
Enzymes [BR:pme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     NATL1_21661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-ProteinID: ABM76722
CyanoBase: NATL1_21661
CYORF: NATL1_21661
UniProt: A2C5G2
Position
1823252..1824592
Genome map
AA seq 446 aa AA seqDB search
MNNIKRLLCQWESPEQVAYKLIQEWGEAGFIWLDGDGSDLGRWVTLGINPLEQFCSRELE
NSKKYSNPFKILRELPQGHWTGWLSYEAASWTEPQNPWQKSSMATLWIASHDPILKFDLQ
KRELWLEGKDPKRISIMENFLKSTFHQKLSKPDSEAAKQAECKHSIPLESWDWRLTSQEY
SERVDEIKEWIANGDIFQANLTTSCQAPLPESMRPIDVYSKLKKYSPAPFAGVIIGDQMA
KGEAIISTSPERFLKALPSGEVETRPIKGTRPRDRDPEKDADWAAELICSPKDHAENVMI
VDLLRNDLGRVCQPGSINVPHLLVLESYSQVHHLTSVVKGRLNTNKTWVDLLEACWPGGS
VTGAPKLRACKRLYELEPTARGPYCGSILNINWDGVLDSNILIRSLMIKESSISAHAGCG
IVADSDSQKEAEEMNWKLMPLLNALT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatattaaacgactactatgtcagtgggaatcacctgagcaagtagcctataaa
ttgattcaagaatggggagaggcgggatttatatggcttgatggcgatgggagtgattta
ggtcgatgggtcaccttaggaattaatcctttagaacagttttgctctagagaattagaa
aattcaaaaaagtactctaatccttttaaaattttacgcgaattaccccaagggcattgg
actggttggttgagttatgaagctgcatcttggacagaaccacaaaacccatggcaaaaa
agttccatggcaactttatggatagcctctcatgacccaatattaaaatttgatcttcag
aagagagagctatggctagaaggcaaagatccaaaacgcatctctattatggaaaatttt
ctaaaaagtacttttcatcaaaagctttctaaaccagacagtgaagcagcaaaacaagca
gaatgcaaacatagtattcccctagaatcttgggactggcggttaacaagtcaagaatat
tctgaaagagttgatgagatcaaagaatggattgcgaacggtgatatttttcaggctaat
ctaactacctcatgccaagccccattgccagaatcaatgcgtccaatagacgtatattca
aaacttaaaaaatactcccctgctccatttgctggagtaattatcggcgatcagatggca
aaaggagaagctattatatcaacttcaccagaaagatttttaaaagcgttacccagtggt
gaggtggaaacgagaccaatcaaaggtactagaccaagagatagagatccagaaaaagat
gctgattgggcagcagagcttatttgtagtccaaaagatcatgctgagaatgtaatgatt
gtagatctactaagaaatgatcttggaagagtatgccaacctggttcaatcaatgttcct
catctactagttttagaaagctattcacaagttcatcatctcacttcagtagttaaaggt
agactcaatacaaataagacttgggttgacttacttgaagcctgctggccaggaggttca
gtaacaggagcaccgaagcttagagcatgtaaaagattgtatgaacttgaaccaacagcg
agaggtccatattgtggatcaatattaaatataaattgggatggagtacttgatagtaat
attctcattcgatctttaatgattaaagaatcttctatcagtgctcatgctggatgtgga
attgttgcagattcagatagtcaaaaggaagctgaagaaatgaattggaaattgatgcca
cttttaaacgcattaacatga

DBGET integrated database retrieval system