KEGG   Prochlorococcus marinus MIT 9303: P9303_06681Help
Entry
P9303_06681       CDS       T00466                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00230  Purine metabolism
pmf01100  Metabolic pathways
Module
pmf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    P9303_06681 (gmk)
Enzymes [BR:pmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     P9303_06681 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_22 AAA_18 AAA_33 ABC_tran MMR_HSR1 ATPase_2 AAA_29 AAA_30 cobW
Motif
Other DBs
NCBI-ProteinID: ABM77419
CYORF: P9303_06681
UniProt: A2C7F9
Position
629196..629774
Genome map
AA seq 192 aa AA seqDB search
MQSMAPSAAEGKLTVITGPSGVGKGSLVKQLLELHPEIWLSISATTREARQGEIEGDHYF
FLNRDRFAELVQAGGCLEWAEFAGNRYGTPRQPVEQQLSLGRPVLLEIELEGARQVRRSF
PEAFQIFLAPPSFEELERRIRGRATDPEEAIQRRLARAREELMAQQEFDAVVINDNLQVA
VIELESLMGLSC
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaatggctccatccgccgctgaaggaaagctcacggtgattactgggcccagt
ggcgttggtaagggttcgttggtgaagcaactcctagagctccatccagagatctggctg
tctatttcggcgacaacgcgtgaagccaggcaaggcgagattgagggtgatcattacttc
ttcttgaaccgtgatcgctttgcagaactggttcaagctggcggttgtcttgaatgggct
gaatttgcaggcaatcgctatggcaccccacgccaacctgttgagcagcagctttcatta
ggccgtccggttttgcttgagattgaactggaaggggcccgacaggtgcggcgcagtttc
cctgaagcttttcagatttttttggcaccgcccagttttgaggagcttgaacgacgcatt
cgtggacgcgccactgatcctgaagaggcaattcagcgacgtttagctagggcgagggag
gaactgatggctcagcaggagtttgatgcagtggtgattaatgacaacctgcaggttgct
gtgattgagctggagtctttgatgggtctgagctgttga

DBGET integrated database retrieval system