KEGG   Prochlorococcus marinus MIT 9303: P9303_07951Help
Entry
P9303_07951       CDS       T00466                                 

Gene name
chlN
Definition
(GenBank) Light-independent protochlorophyllide reductase subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00860  Porphyrin and chlorophyll metabolism
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9303_07951 (chlN)
Enzymes [BR:pmf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     P9303_07951 (chlN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ABM77546
CYORF: P9303_07951
UniProt: A2C7T6
Position
complement(729125..730381)
Genome map
AA seq 418 aa AA seqDB search
MGSTTLLKESGPREVFCGLTSIVWLHRRMPDAFFLVVGSRTCAHLIQSAAGVMIFAEPRF
GTAILEERDLAGLADAHEELDRVVNDLLARRPEIRTLFLVGSCPSEVIKLDLARVAERLN
GQLQGGVRVLNYSGSGIETTFTQGEDGALKAMVPLMPNSNEAQLLLVGTMANAVEDRLKH
LFERLGIPSVSSLPPRQSTDLPSVGPGTRVLLTQPYLTDTARELKDRGAEILQAPFPLGA
EGSRLWMEAAAQAFGINGSHVATILEPLMVRAQKALSPYKEQLAGKRIFLMPESQLEIPL
ARFLHRECGMELVEVGVPYLNRDMMQSELELLPPNTQVMEGQHVEKQLDRVREQRPDLVV
CGMGLANPLEAEEIATKWSIELIFSPIHGIDQAADLAELFARPLHRRDLLNNQLLVSV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcacgacgctgctaaaggaaagcggacctcgggaggttttctgtggcttgacg
tcaattgtttggctgcatcgacggatgcccgacgccttcttcctcgtggtgggctcacgc
acctgtgcccatctgatccaaagcgccgcaggcgtgatgatctttgcggagccgcgtttt
ggcactgccatcctggaagagcgagacctcgctggattggcagacgcccatgaagagctt
gatcgggtggtgaacgacttgctagcgagacgtcctgaaattcgcaccctctttctggtg
ggttcctgccccagcgaagtgatcaagttagatctggcaagagttgccgagcgactcaat
ggacagcttcaaggcggcgtacgcgtgctgaattactcaggcagcggcattgaaaccacc
tttactcagggagaggacggtgcgctcaaagccatggtgccgttgatgcctaatagcaac
gaagcccagctactgcttgttggcaccatggccaacgcagttgaagatcgtctcaaacat
ctcttcgaacgcctcggcatcccctcagtgtccagcttgccgccaaggcagtcgactgat
ctgccatccgtaggacctggcacccgtgttctgctaacccaaccctacttaactgacacg
gctagggaactcaaagacagaggcgccgagatccttcaagcgcctttcccgctgggagct
gagggaagccgactctggatggaagcggcagcccaagcttttggtatcaatggcagtcac
gttgcaaccatccttgaacctttgatggtgcgcgcccaaaaggctttatcgccctacaaa
gagcaactggctggaaagcgaattttcctgatgcctgaatcccagttggaaattccacta
gcgcgtttccttcacagagaatgtggaatggaactcgtagaagttggagttccttatctc
aatcgagacatgatgcagtctgaattggaactgctaccgcctaacacgcaggtcatggag
ggccaacatgtggagaagcagctcgacagggttagggagcagcgtcctgatctagttgtc
tgcggtatgggtttggcaaatccccttgaagcggaagagattgcaacgaaatggtcaatc
gaattgatctttagccccatccacggcattgatcaagctgcagacctcgccgaactgttt
gcaaggccactgcatcgccgcgaccttctcaacaaccaactcctcgtaagcgtctaa

DBGET integrated database retrieval system