KEGG   Prochlorococcus marinus MIT 9303: P9303_17331Help
Entry
P9303_17331       CDS       T00466                                 

Gene name
prkB
Definition
(GenBank) phosphoribulokinase
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00710  Carbon fixation in photosynthetic organisms
pmf01100  Metabolic pathways
pmf01120  Microbial metabolism in diverse environments
pmf01200  Carbon metabolism
Module
pmf_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmf_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmf_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9303_17331 (prkB)
Enzymes [BR:pmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     P9303_17331 (prkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK APS_kinase
Motif
Other DBs
NCBI-ProteinID: ABM78475
CYORF: P9303_17331
UniProt: A2CAG5
Position
complement(1515996..1516898)
Genome map
AA seq 300 aa AA seqDB search
MSKRHPVVAVTGSSGAGTSTVKRAFEHIFSREKITPAVVEGDSYHRFERMAMKEAMADAL
AKGENFSHFGPEANLFDKLEELFRTYGQTGGGKKRYYLHSTEEAAEHNSRLGTKLDPGQF
TPWEEIPTKTDVLFYEGLHGGVVGDGYDVAACADLLVGVVPITNLEWIQKIHRDNAERGY
SAEAIVDTILRRMPDYINHICPQFSRTDINFQRVPTVDTSNPFICRNIPTPDESFVIIHF
RKGAREKWGIDFGDLLNMINDSFMSSPTSIVVNGGKMGFAMELILTPIIHRLIEDKHKLS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcgtcacccggttgtcgccgttacagggtcctccggagccggaaccagcacc
gtaaagcgggcctttgagcacatattttcccgcgaaaaaatcactcccgctgttgtggag
ggcgatagctaccaccgcttcgagcggatggccatgaaggaagccatggctgatgccttg
gccaagggtgaaaatttctcccactttggcccagaagcgaacttattcgacaagctcgaa
gagctcttccgcacctatggtcaaacagggggtggcaagaagcgttactacttgcatagc
actgaagaggcagcagaacataacagccgcctaggcacgaaacttgaccctggtcagttc
accccttgggaggaaatcccaactaagactgatgttctcttctatgaaggtttgcatggt
ggtgtcgttggtgatggctacgacgtagcagcctgcgctgacctactggttggtgtggtc
ccaattaccaaccttgagtggatacaaaaaatccaccgcgacaatgccgagcgtggctat
tccgcagaagcaattgtggatacgatcctgcgccgcatgcctgattacatcaaccacatc
tgcccacaattcagccgcacagacatcaacttccagagagtgcccactgtggacacctcc
aacccattcatttgtaggaacatccctacgccggatgaaagcttcgtaatcattcacttc
cgcaaaggtgctcgcgaaaaatggggcatcgacttcggagatctgctcaacatgattaat
gactcgtttatgtcgagtccgacaagcatcgtggtgaacggaggcaaaatgggttttgca
atggaattaattttgaccccgatcattcatcgcctgattgaagacaagcacaaactctcc
taa

DBGET integrated database retrieval system