KEGG   Prochlorococcus marinus MIT 9303: P9303_18141Help
Entry
P9303_18141       CDS       T00466                                 

Definition
(GenBank) NADH dehydrogenase subunit NdhL (ndhL)
  KO
K05583  NAD(P)H-quinone oxidoreductase subunit L [EC:7.1.1.2]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00190  Oxidative phosphorylation
pmf01100  Metabolic pathways
Module
pmf_M00145  NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    P9303_18141
Enzymes [BR:pmf01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     P9303_18141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NdhL Ca_hom_mod
Motif
Other DBs
NCBI-ProteinID: ABM78556
CYORF: P9303_18141
UniProt: A2CAP6
Position
1579991..1580197
Genome map
AA seq 68 aa AA seqDB search
MVLAAYVLLGGLYLIVVPLLLYSWMNRRWHCMGKFERLSAYGMVFLFFPGLILFAPFLNL
RLNGQGEV
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgctgcctatgtcttgttaggcggcctctatttgattgttgtccctttgctc
ctctattcctggatgaacagacggtggcactgtatgggcaaattcgagcgtctaagcgcc
tacggaatggtgttcctattctttcccggtttaattctattcgcgccttttttgaatctt
cgccttaatggtcaaggagaggtttga

DBGET integrated database retrieval system