KEGG   Prochlorococcus marinus MIT 9303: P9303_19251Help
Entry
P9303_19251       CDS       T00466                                 

Definition
(GenBank) Predicted bile acid beta-glucosidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00511  Other glycan degradation
pmf00600  Sphingolipid metabolism
pmf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    P9303_19251
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    P9303_19251
Enzymes [BR:pmf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     P9303_19251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N DUF2336
Motif
Other DBs
NCBI-ProteinID: ABM78667
CYORF: P9303_19251
UniProt: A2CB07
Position
complement(1693029..1695542)
Genome map
AA seq 837 aa AA seqDB search
MALFGVSAFRSLLKRGSSLKPWSVPAASWSRAFGLAWQQPYTVRYASNLDDGPWHGMPLG
GFGAGCIGRSPRGDFNLWNLDAGEHWQGSIPDCQFALFERQGDQVRAHALATAPQTDDSQ
PELDKPLSSWSWYPASTEQRTTGSYSARYPLSWTHYKGVFAAELVCEAFSPILPGDYRRT
SYPLAVFRWQLQNPTSQSLELSLLLSWRNTCGWFTNTDPSASVHFRDDGSPEHSYVPAIG
RGEGQCNRWIDQPGLIGVLMEGERADPLAEGQGQWCLAVPDHLPGVEVMRCSRWDPSGDG
SELWSSFASEGTIPNSNDTHKSLAGEQTSAALAVKVTLAPGESLEIPVVISWDLPVTAFA
TGVRDLRRYTDFHGSDGQAAAALAAEALRDWPDWREQIDAWQAPVLAREDLPERLRMALF
NELYDLASGGSLWTAARPGDPVGRFGVLECFDYAWYESLDVRLYGSLALLQLWPELDKAV
LRSFARAIPAADATPRPIGWYFTQGRGRVEAPRKRAAATPHDLGAPNESPFDATNYTAYQ
DCNLWKDLASDYVLQVWRTFLLSPNGEDLSFLAECWPAAVQALSYLKRFDVNHDGLPDNG
GAPDQTFDDWPLQGVSAYCGALWIAALEAALAMAQRLQLDLGLNTAEEQHQFSGWLEQSR
ANFDRLLWNGEYYKIDAESGTPVVMADQLCGDFYARLLGLPSVVADERSRSSLNAVKEAC
FEGFEGGRLGVANGLCRDGMPLDPKGTHPLEVWTGINFGLAAYYRLMGDATTATAICSAV
VNQVYGGGLQFRTPEAITAVKTYRACHYLRAMAIWALWATHTDWQLIPGAERAGSEG
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggccctttttggcgtttcagctttcagatccttattgaagcgtggatcgagcttgaag
ccttggagtgtgcctgccgctagctggagccgtgcttttggattggcttggcaacagcca
tacacggtgcgttatgccagcaatctcgatgatgggccctggcatggcatgcccctggga
ggtttcggtgccggttgtatcgggcgtagcccgcgcggtgatttcaatctctggaatctt
gatgctggtgaacactggcagggcagcattcctgattgccagttcgctttgtttgagcgg
cagggggatcaggtgcgtgctcatgcgctagctacagcgccacaaaccgatgactctcaa
cctgaactagacaagcctctctcctcttggagctggtatccagccagtacagagcaacgc
acgactggtagctattcagctcgctatccgctcagttggacccattacaaaggagtcttc
gcggctgagctggtttgcgaggcgtttagtccaatccttcctggtgattaccgacgcacc
agctaccccctggccgtgtttcgttggcagctgcagaaccccacatcgcaatctctggaa
ttgtcgttgctgctgagttggcgcaacacatgtggctggtttacgaacaccgatccctcc
gccagcgttcatttccgcgatgacggcagccctgaacacagttatgtgcctgctatcggc
cgtggcgagggccagtgcaatcgttggattgatcaaccaggcctgattggtgtcttgatg
gagggtgagcgagctgaccccttggctgaggggcaagggcagtggtgtttggctgtcccg
gatcatctgcctggtgtggaggtgatgcgttgtagtcgttgggatcccagcggagatggc
agcgaactgtggagttccttcgcaagtgaaggaaccattccaaacagcaatgacacgcac
aagagcttggcgggcgagcagaccagcgctgctttagcggtgaaggtcaccctggcgcct
ggtgaaagtcttgagatccctgtggtgatcagttgggatctaccggtgacggctttcgct
acaggcgttcgcgatttgcggcgttataccgactttcacggcagcgatggtcaggccgcc
gccgctctggcggccgaggccttgcgtgattggcctgattggcgtgagcagattgatgcc
tggcaggcgccggtgttggcgcgtgaggatttgccggaacgcttgcgaatggctttgttc
aatgagctctacgacttggctagcggtggcagcctttggacggcagcccgtccaggagat
ccggtggggcgctttggggttcttgagtgcttcgactacgcctggtacgaaagtcttgat
gtgcgcctctatggctccttggctctgctgcagttgtggcctgagctcgataaggctgtt
ttgcgtagttttgctcgagccattccagctgcagatgccacgccacgaccaatcggctgg
tacttcacccaggggcgtggccgggtcgaggccccccgcaagagggcggcggctaccccc
catgatctgggagcaccgaatgagtcgccgtttgatgccaccaactacaccgcttatcag
gattgcaatctctggaaagatctggccagtgattatgtgttgcaggtatggcgaacgttt
cttctctcacccaatggcgaagatctgagcttcttggctgaatgctggccggcggcagtg
caagccctcagttatctcaagcgctttgatgtcaatcacgatggtctacccgataacggt
ggtgcgccagatcagacctttgacgattggcctttacaaggcgtgagcgcctattgcggt
gctctttggattgcagctcttgaggctgctctagccatggcacagcgcttgcaattggac
ttaggactcaatacggcagaggagcaacatcagttcagcggttggcttgagcaatcacgg
gccaacttcgatcggctgctttggaatggggagtactacaagattgatgctgagagtggt
acgcccgtggtgatggctgatcaactctgcggcgatttttatgctcgcttgctggggctg
ccctctgttgttgctgatgaacgcagtcgcagcagtctgaatgcagtcaaagaggcctgc
tttgaaggctttgaaggcggccgtttgggagttgccaatggtttgtgccgtgatggcatg
ccacttgatcccaagggaacccatcccttggaggtatggactggcatcaacttcggtcta
gcggcctactaccgactgatgggcgatgcaacgacggccacagccatctgttcagcggtg
gtcaatcaggtgtatggcggtggtttgcaattccgcaccccagaagcgattactgcagtg
aagacctacagggcttgccactatttgcgtgcaatggcgatctgggccctgtgggcaaca
catacggattggcagttgattccaggtgccgaacgggcagggtctgaggggtga

DBGET integrated database retrieval system