KEGG   Prochlorococcus marinus MIT 9303: P9303_27141Help
Entry
P9303_27141       CDS       T00466                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00520  Amino sugar and nucleotide sugar metabolism
pmf01100  Metabolic pathways
pmf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    P9303_27141 (nagA)
Enzymes [BR:pmf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     P9303_27141 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: ABM79444
CYORF: P9303_27141
UniProt: A2CD84
Position
2392314..2393516
Genome map
AA seq 400 aa AA seqDB search
MTTMPWSRTSTTWPPPMHRITHIRLPQPLNAIDTKLWWMAVDEHERVLSVQPMADGSAMD
GESWQGDWISPMGIDLQINGGLGLAFPELTAKDIPQLLKLLDRLWQDGVQAICPTLVSCG
VAALRQSLTVLHAAREQHCPQRCELLGAHLEGPFLAMARHGAHPLEHLCAPSLRALDERI
RGFEQDISLMTLAPELPGSSEVIERLRTLDIVVCLGHSNADGEASADAFSQGVGMLTHSF
NAMPGLHHRAAGPVGEACMHGEIAMGLIADGVHVDPTMAVLLQRLAPQQLVLVSDSLAPY
GLKDGKYRWDERVLLVEKGTCRLEDGTLAGVTLPLLEGSRRLATWSGEPAAAIWAATMAP
RQVMGNGRTLDELLVNQPLTDLLRWQWKPDTEELIWKHAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaatgccatggtcccgcactagcaccacctggccacctcccatgcatcggatc
acccacatccgcctgccccaacctctaaatgccatagacaccaagctgtggtggatggcc
gtagatgagcacgagcgggtgctcagtgttcaacccatggcagatggctctgccatggac
ggggagagctggcagggcgactggatcagtcccatgggcatcgatctacaaatcaatgga
gggctgggattggccttccccgagctcaccgccaaagacattccccagctcctgaagctg
ctcgacagactctggcaagacggtgtacaggcaatctgccccacgcttgtgagctgcggc
gtagcagccctgcgtcaatctttaacggtgctgcatgcagcccgagaacaacactgcccg
caacgctgtgaactactaggggcccaccttgaaggcccttttctggcaatggcacgccac
ggcgcccatcccctggagcatctctgtgctccgagcctaagggcactggatgaacgcatt
cgcggctttgaacaagacatcagtctgatgaccctggctccagaactgcccggatcctct
gaagtgattgaacgactaaggaccctagacatcgtggtatgcctagggcactcgaacgca
gatggggaagcctctgccgatgccttctcccagggagtgggaatgctgacccactccttc
aatgccatgcccggtcttcatcatcgtgcagctggcccggtgggggaagcctgcatgcat
ggagagatcgctatgggactgatcgccgatggcgttcatgttgaccccaccatggcggtg
ctattgcaaagactggcaccacaacagctggtacttgtgagcgatagtctcgctccctac
ggcctcaaagatggcaaatatcgctgggatgaaagagttctgctggtcgaaaaaggaacc
tgtcgtttggaagatggcactctggcaggagtcacactgcccctcctggaagggagtcga
cgtttagccacttggagtggtgaacctgccgcggccatctgggctgccaccatggcccct
cgtcaggtgatgggcaatggccgcacactggatgagctacttgtgaatcagcccttaaca
gacttactccgctggcagtggaaaccggatactgaagagctgatctggaagcatgctgct
taa

DBGET integrated database retrieval system