KEGG   Prochlorococcus marinus MIT 9303: P9303_30031Help
Entry
P9303_30031       CDS       T00466                                 

Definition
(GenBank) NAD binding site:D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00260  Glycine, serine and threonine metabolism
pmf00311  Penicillin and cephalosporin biosynthesis
pmf00330  Arginine and proline metabolism
pmf00472  D-Arginine and D-ornithine metabolism
pmf01100  Metabolic pathways
pmf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9303_30031
   00330 Arginine and proline metabolism
    P9303_30031
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    P9303_30031
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    P9303_30031
Enzymes [BR:pmf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     P9303_30031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 ApbA 3HCDH_N NAD_binding_8 NAD_binding_9 HI0933_like UDPG_MGDP_dh_N GIDA Sacchrp_dh_NADP FAD_binding_3 2-Hacid_dh_C NAD_binding_7 ThiF Pyr_redox Thi4 F420_oxidored AlaDh_PNT_C NAD_Gly3P_dh_N TrkA_N Shikimate_DH Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABM79733
CYORF: P9303_30031
UniProt: A2CE23
Position
2657411..2658529
Genome map
AA seq 372 aa AA seqDB search
MHCSSISRMTASTVAIIGAGAVGAGTAWYLAKHGHQVMLIDPKLDQPINRSGALPGTTAS
LGVLMGHVFRRSSGRAWRLRQHSMTLWPEWVAELSSQEHPLKLNTPLIQLASSEAEATLM
KQLTEQRQHLGLELISPNSNPCMGRSWPNTQHGGLISHQDGYLDPIALQQCLRAALQDQG
VQQIQEPVVSLERNSSVEEKQWRLQLAGGTNLNQDAVVICAALGSEALLEQLGHSLPMAP
VLGQVLDLEVISDQHNWSGWPAVLVSHGINLIPHGPNQIWIGATLEPGVQPIASHLKAMQ
HLEGDAPDWLESATVKDQWHGLRARPVERPAPLLEKLEPGLIVATGHYRNGVLLAPASAA
WVKEQLTNETRS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcattgctcgtcaatatcaagaatgactgcttccaccgttgcaatcattggtgccggt
gcggttggcgctggcacagcctggtatttagccaagcatggccaccaagtgatgctgatt
gatccaaaactggatcaaccgattaaccgatcaggggccctcccgggaacaactgcttcg
ctaggggtactcatggggcatgttttcaggcgcagcagtggacgagcctggcgactccga
caacacagcatgaccctctggccagagtgggttgcagaactgagcagtcaagagcatccg
ctcaagctcaacacgcctctgattcaacttgcgagtagcgaagcagaagccaccctgatg
aagcaactcacagaacaacggcaacatctgggccttgagctgatctcaccaaactcgaat
ccctgcatgggccgatcatggccaaacacccaacatgggggcctgatctctcatcaagac
ggttatctagacccgatcgccctacaacaatgcctacgggccgccctacaagaccaaggc
gtacaacaaatccaagagccagttgtctcgctggaacgaaattcatctgtcgaagaaaaa
cagtggcgccttcaacttgcaggaggaacgaatttgaaccaagacgctgtcgtgatctgt
gcagcacttggcagcgaagccctgctggaacaactaggccacagtcttcccatggcccct
gtgcttggacaagtgctggatctagaggtgatctcagatcagcacaattggagcggctgg
cctgcagtactcgtgagccatggcatcaacctgatcccccacggacccaatcagatctgg
ataggtgccactctcgagccaggagtgcaaccaatagcgagccacctaaaggccatgcaa
cacctcgagggagatgccccggattggttagaaagcgcgactgtgaaagaccaatggcat
ggattgcgcgctcgacctgtcgaacgtccagcacctcttttagaaaaactagagcccggg
ctaatcgtggctacaggccattaccgaaatggcgtcttgctcgccccggccagcgctgca
tgggtcaaagagcaactcactaacgagacaagatcttga

DBGET integrated database retrieval system