KEGG   Prochlorococcus marinus MIT 9301: P9301_01841Help
Entry
P9301_01841       CDS       T00488                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00260  Glycine, serine and threonine metabolism
pmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01130  Biosynthesis of antibiotics
pmg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9301_01841 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9301_01841 (trpB)
Enzymes [BR:pmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9301_01841 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABO16807
CYORF: P9301_01841
UniProt: A3PAN2
Position
complement(170284..171528)
Genome map
AA seq 414 aa AA seqDB search
MVSTFSRKDQNYKNDDLNQPSKEGRFGKYGGQYVPETLMPALFELETAASNAWKDKLFVE
ELNHLLKTYVGRETPLYEAKRLTEHYKTKQATPRIWLKREDLNHTGAHKINNALGQALLA
IRMGKKRIIAETGAGQHGVATATVCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKV
VNSGTATLKDATSEAIRDWVSNVETTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCLE
SFGSFPDILLACVGGGSNAMGLFHPFVKETSVRLIGVEAAGSGVDTDKHAATITKGSVGI
LHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPEHSHLKEIGRAEYGSVTDQEALDALKL
VSELEGIIPALETSHAFAWLDKLCPTLEKDTHIVINCSGRGDKDVNTVASSLDI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagtacattttctcgcaaagatcagaattataaaaatgacgatttaaatcaaccc
tctaaagagggaagatttggaaaatatggtggtcaatatgttcctgaaacgctaatgcct
gctctttttgagcttgaaacagctgcatctaatgcatggaaagataaactttttgtagaa
gaattaaatcatctccttaagacttatgtaggaagagaaacaccactttatgaagccaaa
agacttactgaacattacaaaactaaacaagcaacccctagaatatggcttaaaagggaa
gatttaaatcatactggggctcacaaaattaataatgccctcggacaagctttacttgca
ataagaatgggcaaaaaaagaataattgcagaaactggagcaggtcagcacggagttgct
acggctactgtttgtgcgagatttggcttgaaatgtattatctacatgggtgctgaagat
ataaaaaggcaatcccttaacgttttcagaatgaaacttctaggagctgaagttaaagtt
gtaaattctggaactgcaacacttaaggatgccactagtgaagccattagagattgggtt
tctaatgtcgaaaccacacactacattttaggatctgttgccggcccacaccctttccca
aagattgtgcgagattttcatgcagttataggtgaagaaactaaaaaacaatgtttagaa
tcatttggctcttttcccgatattttgcttgcttgtgtaggtgggggatcaaatgcaatg
gggcttttccatccttttgttaaagaaacttctgtgcgtcttattggagttgaagccgca
ggaagcggagttgatactgacaaacatgctgccacaatcactaaaggttcagttggaatt
ttgcatggatcaatgagtcttctcttgcaagatgataatggtcaagtacaagaagctcac
tcaataagtgcaggtttagattaccctggagtaggacctgaacatagccatttaaaagaa
ataggtagagcagaatatggatcagtcacagatcaagaagctttagacgctttaaaactt
gttagtgaactagaaggaattattcctgcacttgaaacttcccatgcctttgcttggtta
gataaattatgccctactcttgaaaaagatactcatatagttatcaattgctctggaaga
ggcgacaaagatgttaatactgttgcatcttcattagatatttaa

DBGET integrated database retrieval system