KEGG   Prochlorococcus marinus MIT 9301: P9301_01981Help
Entry
P9301_01981       CDS       T00488                                 

Gene name
gshB
Definition
(GenBank) putative Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00270  Cysteine and methionine metabolism
pmg00480  Glutathione metabolism
pmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    P9301_01981 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    P9301_01981 (gshB)
Enzymes [BR:pmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     P9301_01981 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_TupA ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABO16821
CYORF: P9301_01981
UniProt: A3PAP6
Position
complement(183024..183947)
Genome map
AA seq 307 aa AA seqDB search
MKFLFVIDPIKNINPLKDSSAALMQASSKKNIEIWSCTPQDLEARGDEVWASSVKVEVNP
WISFKENECIPLAEFNCIWMRKDPPVNEAYLYATHLLEVAERKGVKVINKPSSLRAWNEK
LGALRYSHLMAPTIVASKVKDLINFANINNEVVIKPLGGKGGQGVIRINKNSPGIKSIIE
LITSQEELPVMMQKFIPEVIEGDKRIIIVNGEAIGSINRIPQGGDFRSNLAMGGKAEPTL
LTEKEKSICSELCQHFKDEGLFFVGIDVINGMLSEINVTSPTGLREIENLSNKNVSEEVI
EKLVEII
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttctattcgtaatagatccaattaaaaatataaatcccttaaaagattcatct
gctgcattaatgcaagcatcatccaaaaaaaatattgaaatctggagttgtacgcctcaa
gaccttgaagctagaggtgatgaagtatgggcatcttccgtaaaagttgaagttaatcca
tggatttctttcaaagagaatgagtgcatccctctcgccgaatttaattgtatttggatg
agaaaagatcctcctgtaaatgaggcttatttgtatgcaacccatcttttagaagttgct
gaaagaaaaggagtaaaagtaataaacaaaccctcatcgttaagagcgtggaatgaaaag
ctaggtgctttaagatacagccacttaatggcacctacaatagttgcgagtaaggtaaaa
gatcttattaattttgcaaatataaataatgaagtagttataaaacctttaggaggaaaa
ggtggtcaaggtgttataaggataaataaaaattctccaggaattaaatcaatcatagaa
ttaatcacttctcaagaagaattacccgttatgatgcaaaaatttattcctgaagtcata
gagggtgataaaagaataattatcgtaaacggagaagcaattggatcaataaataggatt
cctcaaggaggcgattttagaagtaatttagcgatgggaggcaaggctgaacccacatta
ttaacagaaaaagaaaaaagtatctgctcagaattatgtcaacacttcaaagatgagggt
ttattttttgtaggtattgatgtaataaatggaatgcttagcgagattaatgtaaccagt
ccaacaggtttaagagaaatagaaaatttatccaataaaaatgtttcagaggaagttatt
gaaaaattagtagaaattatctag

DBGET integrated database retrieval system