KEGG   Prochlorococcus marinus MIT 9301: P9301_03261Help
Entry
P9301_03261       CDS       T00488                                 

Definition
(GenBank) Selenide,water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00450  Selenocompound metabolism
pmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    P9301_03261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmg03016]
    P9301_03261
Enzymes [BR:pmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     P9301_03261
Transfer RNA biogenesis [BR:pmg03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    P9301_03261
 Prokaryotic Type
    P9301_03261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 AIRS_C AIRS K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABO16949
CYORF: P9301_03261
UniProt: A3PB24
Position
297093..299264
Genome map
AA seq 723 aa AA seqDB search
MAFNHLVLIGGGHSNVSLLKKWLMFPKLMPEIPVSIISRDSHLVYSAMFPSVISKSITLE
ESLINIKSLAKNAKVSFIEEEVKNVDFNLKKIVLSNRPSVNYSKLVLNYGSQTIIPKEFE
SLVKNRNAFSIKPFLRAYDSILKEDIFDSVNELPFVIVGSGLAAIEVSFALRKRWGDRPL
KLLCDSRKINNTILKSLRNSNIDLIEKLNFDYGKILLCTGNTSPLWSQKKLLDSDSYGRI
ITNQNLQIKSFSGIFAVGDCAVVGSAKRPASGVFAVKVVNTLVQNLKKDIEGRSLKKWFP
QKIGLQIVNIFPSHHPKAFAIYRNFVFGPSFIFWILKHKIDLNFIKKFRSKRLIMKSSEK
SISLNDCRGCAAKIPQVVLNKSLINSNLNSFASSPEDSVEIYQNGQDIILQSVDGFPALV
SDPWLNAKITTLHACSDLWACGAKLSSAQALISLPKVEREFQSYLFSQSLQGIKSTVEDQ
GGELLGGHTFEARSLVNKPYSLGIDISLTVQGILKNGAKPWLKSGMNNGDILMMSRPLGV
GIYFAGQMQNINMLDTSSKVINNLVKSQQYLIDEIYLFQNQFKESLVNAATDITGYGFIG
HLKEMVESSNLYRQSNNLEPLKVLLDLFAFKAYPGVFDLIRKDVKSTFFESNKEIFDKIY
KVNKQKRIINFLNENSLDQETFNERISLLLDPQTCGPLLISCNRKYENVLKDKWYKVGEV
VKM
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaatcatctggtactaattggaggaggacactcaaatgtttctttattgaag
aaatggttaatgtttccgaaattaatgccagaaattcctgtttcaattatatctagagat
tctcatttggtttattcggcgatgttcccatcggtgatttcaaaatcaatcactttagaa
gagagtttaattaatataaaatctttggcaaaaaatgcaaaagtatcttttatagaagaa
gaagtaaagaatgttgatttcaatttaaagaaaattgttttaagtaatagaccttcagtt
aattattctaagttggtgcttaattatggaagtcaaacaataattccaaaagaatttgaa
tcactagttaaaaatcgaaatgctttttcaattaaaccttttttaagggcttatgactca
atcctaaaagaggacatttttgattcagttaatgaacttccatttgtaatagttggcagt
ggtcttgctgcaattgaagtatcatttgctttgagaaaaagatggggagatagaccttta
aaactattatgtgattcaagaaaaattaataatacaattctaaaaagtttacggaattcc
aatattgatttaattgaaaaacttaattttgattatggcaagattcttttatgtactgga
aatacatctccgttatggtcacaaaaaaaattattagattcggattcttatggcagaata
attacaaatcagaatttgcagataaaaagtttctctggaatctttgctgttggcgattgc
gcagttgtaggttcagcaaaaagaccagcatcgggagtttttgcagtaaaagttgtaaat
acattagtacaaaatctaaaaaaagatatagaaggaagatcattaaaaaagtggtttccc
caaaagatcggattacaaatagtaaatatatttccaagccatcatccaaaggcttttgct
atttatcgcaattttgttttcggcccttcttttattttttggattttaaagcataaaatt
gatctcaactttattaaaaagttcagatcaaaaaggctaattatgaaaagtagtgaaaaa
agtatttctttgaatgattgcagaggatgtgcagctaaaattcctcaagttgttttgaat
aaatcattaataaattctaatttaaattcttttgcctcatcacctgaagattcagttgag
atatatcaaaatggtcaagatattatcttgcaaagtgtagatggatttcctgctttggta
agtgatccttggcttaatgcaaaaattactactttgcatgcttgctcagatttgtgggca
tgcggcgcaaaactttcatccgcgcaggctttaatttcattaccaaaagttgaaagggaa
tttcagagttacctcttttctcaatcacttcaaggaattaaatcaacagttgaggatcaa
ggaggtgaattacttggaggccatactttcgaggcaagaagtttagtaaataaaccttat
tcattaggaatagatatttctttaacagttcaaggtattttaaaaaatggagcaaaacca
tggcttaaatctggaatgaataatggagatattctcatgatgtctagacctctgggggtt
gggatttactttgccggtcaaatgcaaaatattaatatgctagatacttcttctaaagta
attaataatttagtaaagagtcagcaatatttgattgatgaaatttatctttttcaaaat
caatttaaagaatcattagtcaatgctgcgactgatattactggatatggatttattgga
catcttaaagaaatggttgaatcatctaatttatataggcaaagcaataatcttgaacca
ctaaaagttttattagatttatttgcatttaaagcttatcctggagtatttgatttaata
agaaaagatgttaaaagtactttctttgaatctaataaagaaatttttgacaaaatttat
aaagtaaataagcaaaaaagaataattaattttttaaacgaaaattcattagatcaagag
acttttaacgagagaatatcattactattagatcctcaaacatgtggacctttgttgatt
agttgcaatcgtaaatatgaaaatgttctaaaggataaatggtacaaggttggagaggtt
gtaaaaatgtaa

DBGET integrated database retrieval system