KEGG   Prochlorococcus marinus MIT 9301: P9301_06701Help
Entry
P9301_06701       CDS       T00488                                 

Gene name
metA
Definition
(GenBank) putative homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00270  Cysteine and methionine metabolism
pmg00920  Sulfur metabolism
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01130  Biosynthesis of antibiotics
pmg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    P9301_06701 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    P9301_06701 (metA)
Enzymes [BR:pmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     P9301_06701 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     P9301_06701 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS DUF3173
Motif
Other DBs
NCBI-ProteinID: ABO17293
CYORF: P9301_06701
UniProt: A3PC18
Position
596514..597464
Genome map
AA seq 316 aa AA seqDB search
MILKPISNKHFHKSHRKGDLLALIIPGNYHKISDVEKNHISWIEPELAKRQDIRPLRIGI
LNIMPLGKQYEFNLLHPLGLSPLQIEPVWIKLKTHSYKTWDLNHLNNLYVTWEEANNPEP
LDGIIITGAPIEHLAFEDVNYWDEFVKIVNEARTSCASTLGLCWAGFALAYLAGVDKQVF
DRKLFGVFPLKSLVPGHPLMGTQDDEFICPQSRFAGLPDLEMEKAQKEGKLNLLAYGENV
GYTIFESIDQKQLMHLGHPEYTVHRIISEIERDKEKGDVPPPKNFDPNSSKTAWRSHRNL
LFQQWLWFCYQQVSLN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaagccgatttcgaacaagcactttcacaaatcacataggaaaggagattta
ttggctttaataattcctggtaattatcacaagattagtgatgttgagaaaaatcatata
tcttggatcgaaccagaattggcaaaaagacaggatatacgtcctcttaggattggtatt
ttgaatattatgcctcttggtaagcagtatgaatttaacttgctacatccacttggttta
tctcctcttcaaatagagcctgtttggataaagcttaaaactcactcttataagacatgg
gatcttaatcatctaaataatctatacgttacttgggaagaagcaaataatccagaaccg
ttagacggaatcataattactggggcacctattgagcacttagcctttgaggatgttaat
tattgggatgaatttgtgaaaattgtaaatgaagctagaacttcttgtgcgagtactctt
ggattatgttgggcgggctttgctctggcttatttggcaggagttgataagcaagttttt
gataggaaattatttggggtattccctttaaaaagtcttgttccaggacaccctttgatg
ggtacacaagatgatgaatttatatgtcctcaaagtagatttgcaggattaccagattta
gaaatggagaaggcccaaaaagaagggaaattgaatttgttggcttatggagaaaacgtc
ggatatacaatatttgaatctattgatcaaaaacaacttatgcatttaggtcatcctgaa
tatacggtgcatagaattattagtgaaattgaaagagacaaagaaaagggagatgttcct
cctcctaaaaattttgatccaaatagttcaaaaaccgcttggagatcgcataggaatttg
ctttttcagcaatggctttggttttgttatcaacaagttagtcttaattaa

DBGET integrated database retrieval system