KEGG   Prochlorococcus marinus MIT 9301: P9301_09261Help
Entry
P9301_09261       CDS       T00488                                 

Gene name
ispE
Definition
(GenBank) Putative 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (CMK)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00900  Terpenoid backbone biosynthesis
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P9301_09261 (ispE)
Enzymes [BR:pmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     P9301_09261 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABO17549
CYORF: P9301_09261
UniProt: A3PCS4
Position
796714..797649
Genome map
AA seq 311 aa AA seqDB search
MQDLAKPKIKIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLSDYLEFEINNEGLIKLE
SDCNDLSLSDDNLIVKSANLLRKNSNINYGANIFLRKNIPIGAGLAGGSSNAAATLIGLN
KLWNLDLDHGTLCSLASTLGSDIPFFINGGIQLCFGRGEILEKLDSNFEYGVILLKNPNV
SVSTAETYKKYSNRFCDNHLNDRKMIENIRKNLRDNGLNKLNFDNQHLFIKNDLQLVVEN
ENDSVKQALYLLSKLENCLTFSMSGSGPTCFALFKDIETAKKELTANSKFFKDKGYDSWV
CTFLEKGITFI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttagctaaaccgaaaattaagataaaatctcctgccaaaataaatttgcac
cttgaagttattggtaaaagagaggatggatttcatgagttagcaatgattatgcaaaat
atcgatctttctgattatttagaatttgaaataaataatgaaggtttaattaaacttgag
tctgattgtaatgatttaagcttgtctgatgataacttaattgttaaatcggcaaatcta
ttaagaaaaaattcaaatataaattacggtgcgaatatatttttaagaaaaaatattcca
attggcgcaggattagctggtggatccagtaatgcagcagcaacattaattggtcttaat
aagttatggaatttggacttagatcatggaacattatgttcattagcatcaactttagga
tctgatattcccttttttataaatggtggcattcagttatgttttggaagaggagaaatt
ttggagaaattagattcaaactttgaatatggagtaattcttttaaaaaatccaaatgta
tcagtatctacagctgaaacttataaaaaatatagtaatagattttgtgataatcatctt
aatgatagaaaaatgattgagaacataagaaaaaatttaagggataatggtttgaataaa
ttaaattttgataatcaacatttatttattaaaaatgatttgcagttagttgttgaaaat
gaaaatgattctgtaaagcaggcattatatttactttctaaactagaaaattgtctcaca
ttttcaatgagtggatcaggacctacatgctttgcactctttaaagatatagagactgca
aaaaaagaattaactgctaattctaaattttttaaagataaaggctatgattcatgggtt
tgcactttccttgaaaagggaataacattcatttaa

DBGET integrated database retrieval system