KEGG   Prochlorococcus marinus MIT 9301: P9301_10411Help
Entry
P9301_10411       CDS       T00488                                 

Gene name
tpi
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00010  Glycolysis / Gluconeogenesis
pmg00051  Fructose and mannose metabolism
pmg00562  Inositol phosphate metabolism
pmg00710  Carbon fixation in photosynthetic organisms
pmg01100  Metabolic pathways
pmg01110  Biosynthesis of secondary metabolites
pmg01120  Microbial metabolism in diverse environments
pmg01130  Biosynthesis of antibiotics
pmg01200  Carbon metabolism
pmg01230  Biosynthesis of amino acids
Module
pmg_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9301_10411 (tpi)
   00051 Fructose and mannose metabolism
    P9301_10411 (tpi)
   00562 Inositol phosphate metabolism
    P9301_10411 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9301_10411 (tpi)
Enzymes [BR:pmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P9301_10411 (tpi)
Exosome [BR:pmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P9301_10411 (tpi)
  Exosomal proteins of bladder cancer cells
   P9301_10411 (tpi)
  Exosomal proteins of melanoma cells
   P9301_10411 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABO17664
CYORF: P9301_10411
UniProt: A3PD39
Position
complement(901889..902614)
Genome map
AA seq 241 aa AA seqDB search
MRKSVIAGNWKMHMTCAEAKSYLEEFIPLIKNIKDDRKVVIAPPFTAISTFSDHSDFEYL
DISSQNIHWEDQGAFTAEISPKMLLEHGVSYAIVGHSEPRKYFSESDEQINKRAVFAQSS
GLTPIVCVGETLEQRERGEADRVITRQVEQGLENTDPSNLIVAYEPIWAIGTGKTCEAED
ANKICSLIRKLIGFDDVIIQYGGSVKPNNIDEIMSMSDIDGVLVGGASLDPNSFARIANY
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaatctgtaattgctggtaattggaaaatgcacatgacttgtgctgaagctaaa
tcctatttagaagagtttattcctttaataaaaaacattaaagacgatcgtaaagttgtt
attgctccaccttttacggctatttcaaccttttctgatcattctgattttgaatattta
gatatttctagtcaaaatattcattgggaagatcaaggagcgtttacggcagaaatatcc
cccaaaatgcttcttgaacatggtgtctcatatgcaatcgttggacatagtgaaccaaga
aaatattttagtgaaagtgatgagcaaattaacaaaagagcagtttttgctcaatcaagt
ggacttactccaatagtttgtgtaggagaaacattagaacaaagagagagaggagaggct
gatagagttattactagacaggttgaacaaggattagaaaatacagatccatctaattta
attgttgcctatgaaccaatatgggctattggcactggtaaaacgtgtgaggcagaagac
gctaataagatatgttctttgattcggaaattaataggttttgatgatgtaattattcaa
tatggaggatctgttaagcctaataatatcgacgaaatcatgtcaatgagtgatatcgat
ggggtgctagtcggaggggcttcattagatccgaatagtttcgcgagaattgcaaattat
caataa

DBGET integrated database retrieval system