KEGG   Prochlorococcus marinus MIT 9301: P9301_12041Help
Entry
P9301_12041       CDS       T00488                                 

Gene name
recR
Definition
(GenBank) RecR protein
  KO
K06187  recombination protein RecR
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    P9301_12041 (recR)
DNA repair and recombination proteins [BR:pmg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     P9301_12041 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      P9301_12041 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim IMS_HHH HHH_8 HHH_5 Cdd1
Motif
Other DBs
NCBI-ProteinID: ABO17827
CYORF: P9301_12041
UniProt: A3PDK2
Position
complement(1018124..1018723)
Genome map
AA seq 199 aa AA seqDB search
MITYTKPLSKLIGHFEKFPGIGPRTAQRLALFILKQPESTIREFSKALLEAHSNVGRCKK
CFNLTSEDECEICRNTERNQKLICVVAETKDLLALERAREFKGVYHVIGGLISPMDSVGP
ELLEIRSLVERVSKSEIDEIILALTPSVEGDTTSLYIGKLLAPFTKVTRIAYGLPMGSEL
EYVDEVTLARALEGRTKLN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgattacttataccaaaccactttcaaaattaatcggtcattttgagaaattcccaggg
attggtccaagaacagcgcaacgattagccctgtttattttaaaacaacctgaaagcaca
ataagagaattttcaaaggctctgttagaagcacatagtaatgtgggtcgttgcaaaaaa
tgtttcaatttgacttcagaagatgaatgcgaaatatgtagaaatactgaaagaaatcaa
aaactaatctgtgtagtagcagaaacaaaagatttacttgctttggagcgcgccagagaa
tttaaaggtgtttaccatgttattggtggtttaatatccccaatggattctgttggccct
gaactcttagaaataagaagcttggtagaaagagtaagtaagtctgaaatagatgagatc
atattggcattgaccccaagtgttgagggagatacaacaagtctttatattggaaaattg
ttagctccttttactaaagttacgaggattgcatatgggcttccaatgggcagtgaactt
gaatatgtggatgaagttacacttgcaagggccttagaaggtagaacaaaactaaattag

DBGET integrated database retrieval system