KEGG   Prochlorococcus marinus MIT 9301: P9301_17441Help
Entry
P9301_17441       CDS       T00488                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    P9301_17441 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pmg03011]
    P9301_17441 (rplV)
Ribosome [BR:pmg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    P9301_17441 (rplV)
  Bacteria
    P9301_17441 (rplV)
  Archaea
    P9301_17441 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABO18367
CYORF: P9301_17441
UniProt: A3PF42
Position
complement(1469006..1469392)
Genome map
AA seq 128 aa AA seqDB search
MTTTPETQKTAVAHGNYVRGSASKVRRVLDQIRGRSYRDALIMLEFMPYRSTDPITKVLR
SAVANAEHNLGMDPSTLVISSAWANSGPVMKRYRPRAQGRAFSIKKQTCHISISVESAPT
QTNAEVQN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacacctgaaacacaaaaaacagccgttgcacatgggaactatgttcgcgga
tcagcctctaaagtgagaagagttttggatcagataaggggtaggtcctatagagatgca
ttgattatgttggaatttatgccttacagatctacagaccctattactaaagttctaaga
tctgcggttgccaatgcagaacataaccttggaatggatccatctaccttagttatttcc
tctgcatgggctaatagtggtcctgtaatgaaaaggtataggcccagagctcaaggtcga
gctttttcaattaaaaaacagacttgccatataagtatttctgtagaatctgctcctacc
caaactaatgcggaggtacaaaactaa

DBGET integrated database retrieval system