KEGG   Prochlorococcus marinus MIT 9215: P9215_01821Help
Entry
P9215_01821       CDS       T00598                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00260  Glycine, serine and threonine metabolism
pmh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01130  Biosynthesis of antibiotics
pmh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9215_01821 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9215_01821 (trpB)
Enzymes [BR:pmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9215_01821 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABV49801
CyanoBase: P9215_01821
UniProt: A8G2H0
Position
complement(166258..167502)
Genome map
AA seq 414 aa AA seqDB search
MVSTFSRKNQNYKKDDLNQPSKDGRFGKYGGQYVPETLMPALFELETAASNAWKDKLFVK
ELNHLLKTYVGRETPLYEAKRLTEYYKTKKAIPKIWLKREDLNHTGAHKINNALGQALLA
IRMGKKRIIAETGAGQHGVATATVCARFGLKCIIYMGAEDIKRQSLNVFRMKLLGAEVKV
VNSGTATLKDATSEAIRDWVSNVESTHYILGSVAGPHPFPKIVRDFHAVIGEETKKQCLE
SFGSLPDILLACVGGGSNAMGLFHPFVKETSVRLIGVEAAGGGVDTDKHAATITKGSVGI
LHGSMSLLLQDDNGQVQEAHSISAGLDYPGVGPEHSHLKDIGRAEYGSVTDQEALDSLRL
VSELEGIIPALETSHAFAWLDKLCPTLEKDTHIVINCSGRGDKDVNTVASSLDI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagtacattttctcgcaaaaatcaaaattataaaaaagacgatttaaatcaacca
tccaaggatggaagatttggcaaatatggaggtcaatatgttcctgaaacgctaatgcct
gctctttttgagcttgaaacagctgcatcaaatgcatggaaagataaactttttgtaaaa
gaattaaatcatctacttaagacttatgtaggaagagaaacaccactttatgaagccaaa
agacttactgaatattacaaaactaaaaaagcaattccaaaaatatggcttaaaagagaa
gatttaaatcatactggtgctcacaaaattaataatgcccttggacaagctttattagca
ataagaatgggcaaaaaaagaataattgcagaaactggagcaggtcagcatggagttgct
accgctactgtttgtgcgagatttggcttgaaatgtattatctatatgggtgctgaagac
ataaaaaggcaatcccttaatgtcttcagaatgaaacttctaggagctgaagttaaagtt
gttaattctggaactgcaacactcaaagatgctacaagtgaagccattagagattgggtt
tctaatgtcgaatccacacactatattttaggatctgttgccggcccacaccctttccca
aagattgtgcgagattttcatgcagtcataggagaagaaactaaaaaacaatgtctggaa
tcatttggatctttacccgatattttgcttgcttgtgtaggtgggggatcaaatgcaatg
ggccttttccatccttttgttaaagaaacttctgtacgacttattggagtagaagccgca
ggaggcggagttgatacggataaacatgctgcaactatcactaaggggtctgttgggatt
ttgcatggatccatgagtcttctcttacaagatgataatggtcaagtacaagaagctcac
tcaataagtgcgggtttagattaccctggagtagggcctgaacatagtcatttaaaagat
ataggtagagcagaatatggatcagttacagatcaagaagctttagattctttgagactt
gttagtgaacttgaaggaattataccagcacttgaaacttcacatgcctttgcttggtta
gataaattatgccctactcttgaaaaagatactcatatagttatcaattgctctggaaga
ggtgacaaagatgttaatactgttgcatcttcattagatatttaa

DBGET integrated database retrieval system