KEGG   Prochlorococcus marinus MIT 9215: P9215_02281Help
Entry
P9215_02281       CDS       T00598                                 

Definition
(GenBank) possible kinase
Organism
pmh  Prochlorococcus marinus MIT 9215
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC1 APH Pkinase
Motif
Other DBs
NCBI-ProteinID: ABV49847
CyanoBase: P9215_02281
UniProt: A8G2L6
Position
complement(209496..211163)
Genome map
AA seq 555 aa AA seqDB search
MSYHILHYRFKKMRRASLIWITLILLLINLWIDNIRFTIFQTKDNEKSRIQLQRARWFTN
QLIKLGSAFIKIGQLLSARPDLIPNTWIQELSKLQDQVPNFPFEQVEETIRDELGSKFNE
IDQIILDPIGSASLAQVHRATLKDGKKVVFKVQRPNLKELFIIDLGIMQQIAGLLQKNKN
WSRGRNWVEIAKECRKVLMKELDFNSEAQYAARFRQQFLDDHNVEVPEVIWDMSSEKVLC
LSYLEGTKISDLEKLRAQEIDLFKIAEIGAISYLKQLVNYGFFHADPHPGNLAVSNEGKL
IFYDFGMMGNISNNLQSRLGGMVKAAALRDASSLVSQLQQAGLISKDIDVGPVRRLVRLM
LKEALTPPFSPNIIEKLSGDLYELVYETPFQLPVDLIFVMRALSTFEGVGRMLDPGFNLV
SVTKPYLIELMTSNNQTPNDLINQFGRQVGELGSKAVGIPKRIDESLERLEQGDLQLQIR
MGESDRQFKKMFTAQKTLGHSILIGSLSIASALLVTNNQNNFALLPLFFAVPISIDWIKC
QLSMRKGSRLEKLKR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcacattcttcattatcgttttaaaaagatgaggagggcatctcttatttgg
ataactctgattttgcttctaataaatttatggatagataatattagatttacaattttc
caaactaaggataatgaaaaaagtaggatccaacttcaaagagctaggtggtttactaat
caattaataaaacttggttcagcatttattaaaattggacaattattatcagcgagacct
gatttaattcctaatacttggatacaggaattgtctaaattgcaggatcaagttcctaat
tttccatttgagcaagttgaagaaactataagagatgaattagggtctaagtttaatgaa
atagatcaaataatattagatccgattggatcagcatcactagctcaggttcatagggcg
actctaaaagatggtaagaaagtagtatttaaagttcaaagacccaatttaaaggaattg
tttattatcgatttgggcataatgcagcaaatagcaggattgttacagaaaaataagaat
tggagtcgaggtagaaactgggttgagattgctaaagagtgtagaaaagttcttatgaaa
gagcttgattttaatagtgaagctcaatatgcagcaagatttagacagcaatttcttgac
gatcataatgttgaagttcctgaagtaatttgggatatgagcagtgaaaaagtactttgt
ttaagttatctagaaggaacaaaaataagcgatttagaaaaattacgagcacaagaaatt
gatttatttaaaattgctgaaataggtgcaataagctatttaaaacaattagtaaattac
ggtttttttcatgcagaccctcatccagggaatctagcagtttccaatgaaggtaaatta
attttttatgattttggaatgatgggcaatatctcaaataatcttcaatcaagattgggg
gggatggttaaggctgctgctcttagagacgcctcatcacttgttagtcaattacaacaa
gctgggcttatttcaaaagatattgatgtaggaccagtgaggagattagtcagattgatg
cttaaagaagccttaacaccaccatttagtccaaatattattgaaaaattatctggagat
ttatacgaacttgtttatgaaacaccatttcaactaccagtagatttaatctttgtgatg
agagctttatcaacttttgaaggagttggtagaatgcttgacccagggtttaaccttgta
tcagttaccaagccttatttaatagaacttatgacctcaaataatcaaactcccaacgat
ttaattaaccaatttggaaggcaagtaggtgaactaggatcgaaagccgttggaattcct
aaaagaatagatgaaagtttagaaagattagagcagggcgatttacaattacaaataaga
atgggagagtctgataggcaattcaaaaaaatgtttactgctcaaaaaactttaggccat
tcaattctgataggaagcttatcaattgcatctgctttacttgtaaccaataaccaaaat
aattttgcattattgccgcttttttttgcagtaccaataagtattgattggataaaatgc
caattaagtatgagaaaaggctcacgtttagagaaacttaagcgctaa

DBGET integrated database retrieval system