KEGG   Prochlorococcus marinus MIT 9215: P9215_02351Help
Entry
P9215_02351       CDS       T00598                                 

Gene name
hemB
Definition
(GenBank) Delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00860  Porphyrin and chlorophyll metabolism
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01120  Microbial metabolism in diverse environments
Module
pmh_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9215_02351 (hemB)
Enzymes [BR:pmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     P9215_02351 (hemB)
Exosome [BR:pmh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P9215_02351 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD MOFRL
Motif
Other DBs
NCBI-ProteinID: ABV49854
CyanoBase: P9215_02351
UniProt: A8G2M3
Position
215872..216873
Genome map
AA seq 333 aa AA seqDB search
MNSIIRPRRLRRTQSIREMVRENHLTASDFIYPLFIHEKDFKEEISAMPGTYRWDINNLI
KEVTRAWELGIRCVVLFPKINDSLKTEDGAECFNEDGLIPKAIRILKKEIPEMSIMTDVA
LDPYSCDGHDGLVDETGKILNDETIEVLKKQALTQARAGADFIGPSDMMDGRVGAIRAAL
DSQGFSDVGIISYTAKYSSAYYGPFRTALDSAPRENSKKIIPENKSTYQMDPANSKEALI
ESALDQYEGADILMVKPGISYLDIVYRLSTFSNKPIAAYNVSGEYSMVKSAAMKNWINEK
DIVLETLLSFKRAGAKLILTYHACDASQWLQDT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaattattcgtcctagaagattaagaagaactcagtcaattagagaaatggtt
agagaaaatcatctaacggcatcggactttatatatccattatttattcatgaaaaagat
tttaaagaggaaatttcagcaatgcccggaacttatagatgggatattaataacttaata
aaggaggttactagggcatgggaattgggaataaggtgtgtggttctttttccaaaaatt
aacgatagcttaaagactgaagatggagcagaatgttttaatgaagacggtttaatacct
aaagctattcgaatattaaaaaaagagattccagaaatgtcaataatgacagatgttgcc
ttggacccatactcttgtgatggtcatgatggattagttgatgaaactggaaaaatattg
aacgacgaaacaatcgaagttttaaaaaaacaagctttaacacaagcaagagctggagca
gattttattggtcctagtgacatgatggatgggagagttggagcaatcagagctgctctt
gatagtcaaggatttagtgatgtaggtattattagttatacagcaaaatattcatcggct
tattatggtccatttagaactgctttagattcggctcctagagaaaatagtaagaaaata
attccagaaaataagtctacatatcaaatggaccctgcgaattcaaaagaggctttaatt
gaatctgctttggatcagtatgaaggagctgatattttgatggtaaaaccagggatttca
tatttggatatcgtttatagattaagcactttttcaaataaacccatagctgcatacaac
gttagtggggaatattcaatggttaagtctgctgctatgaagaactggattaatgaaaaa
gatattgttttagaaacattgcttagttttaaaagggcaggagcaaaattaatactcact
tatcatgcttgtgatgcatctcaatggttgcaggatacttaa

DBGET integrated database retrieval system