KEGG   Prochlorococcus marinus MIT 9215: P9215_05471Help
Entry
P9215_05471       CDS       T00598                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00230  Purine metabolism
pmh01100  Metabolic pathways
Module
pmh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    P9215_05471 (gmk)
Enzymes [BR:pmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     P9215_05471 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Rad17 RsgA_GTPase AAA_16 AAA_22 NTPase_1 AAA_17 MMR_HSR1 AAA ABC_tran NB-ARC AAA_14 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABV50163
CyanoBase: P9215_05471
UniProt: A8G3I2
Position
481795..482349
Genome map
AA seq 184 aa AA seqDB search
MKNQKKLIILTGPSGVGKGTVVKEILGKEKNFWLSISATTREPREGEKDGENYYFLNREK
FKEMIEQNLFLEWAQFAGNYYGTPLSSVNEKIKKGFIVLLEIEVEGARQIKNKFPNSLSI
FLLPPDKEELERRIRNRGTEKEEAIKKRLSRANYEISVSNQFDFALTNHNVYETAKKIIK
LIKT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaaaaacttattatccttactggacccagtggggttggtaaaggaaca
gttgttaaagaaatattaggtaaagaaaaaaatttttggctatcaatatctgcaactact
agagaacctagagagggagaaaaggacggagaaaattactactttttaaatcgggaaaag
tttaaagaaatgattgaacaaaacctgttccttgaatgggctcaattcgctgggaactat
tatggaaccccattgtcttctgtaaatgagaaaataaaaaagggatttatcgtactactt
gaaattgaagtagagggtgcaaggcaaataaaaaataagtttcctaattcactttctata
tttttacttccaccggataaagaagagttagagagaagaataagaaatagaggtacggaa
aaagaagaggcaattaaaaaaagactctcaagggctaattatgagatttcagtatcaaat
caatttgattttgcattaacaaatcacaatgtttatgaaacagcaaaaaaaataatcaag
ttaataaaaacttga

DBGET integrated database retrieval system