KEGG   Prochlorococcus marinus MIT 9215: P9215_06041Help
Entry
P9215_06041       CDS       T00598                                 

Gene name
btuR
Definition
(GenBank) possible cob(I)alamin adenosyltransferase
  KO
K19221  cob(I)alamin adenosyltransferase [EC:2.5.1.17]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00860  Porphyrin and chlorophyll metabolism
pmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9215_06041 (btuR)
Enzymes [BR:pmh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.17  corrinoid adenosyltransferase
     P9215_06041 (btuR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobA_CobO_BtuR TniB Co_AT_N AAA_26 AAA_14
Motif
Other DBs
NCBI-ProteinID: ABV50219
CyanoBase: P9215_06041
UniProt: A8G3N8
Position
complement(530250..530942)
Genome map
AA seq 230 aa AA seqDB search
MQEKPSSSEKILNLDNQANKLGMGGKLSPDSDESSYKRRMQQRKDIQAERLQIRKTKKGL
LIVFTGDGKGKTTASLGMALRTIGHGYKVAIIQFIKGGWTTGEEKALKNFSSNISWHSLG
EGFTWETQDRIRDEKLVQEAWQLAKKYIQNESYKLIILDEINIATKLGYLAPEEIITFLK
SLNNRKNHIVLTGRGASDSIINYADLVTEMKLIRHPFKDQGIKAQKCVEF
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaccttcatcttcggaaaaaatattaaacctcgataatcaagcaaataaa
cttggaatgggaggtaaattatcacctgacagcgatgagagctcatataaaagaagaatg
cagcaaagaaaagatattcaagccgaaagactacaaattagaaaaacaaaaaaaggatta
ttgattgtttttacaggagatggcaagggcaagacaactgcatctttaggtatggcttta
aggacgatagggcatggctataaagtggcaataattcaatttatcaaaggaggctggacc
actggagaagaaaaagcacttaaaaacttttcttcaaacatatcttggcattcattagga
gagggatttacttgggaaacacaagacagaataagagatgaaaaattagttcaagaggcg
tggcaactagccaaaaaatacattcaaaacgaatcttataaacttatcattcttgatgaa
attaatattgcgacaaaacttggttatcttgcacccgaagaaataatcacttttttaaaa
agcttaaataatagaaaaaatcatattgttttaactggaaggggagcatctgattcaatt
atcaattacgctgatttagttacagaaatgaaacttataagacatccatttaaagatcaa
ggaataaaagcacaaaagtgtgttgaattttag

DBGET integrated database retrieval system