KEGG   Prochlorococcus marinus MIT 9215: P9215_06481Help
Entry
P9215_06481       CDS       T00598                                 

Gene name
gor
Definition
(GenBank) probable glutathione reductase (NADPH)
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    P9215_06481 (gor)
Enzymes [BR:pmh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     P9215_06481 (gor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored HI0933_like Thi4 AlaDh_PNT_C FAD_binding_2 NAD_binding_8 GIDA Lycopene_cycl FAD_binding_3 DAO
Motif
Other DBs
NCBI-ProteinID: ABV50263
CyanoBase: P9215_06481
UniProt: A8G3T2
Position
570364..571743
Genome map
AA seq 459 aa AA seqDB search
MIKKILEFEFDLIVVGAGSGGLAAAKRAASYGAKVAIIEANQIGGTCVIKGCVPKKLMVY
AAKSKKNMDYSEGYGLKNEGINFESNILLKNIREEVSRLSNLHRNSLKKLNIAIFEGLGR
FITQNELEIICSNTKKIKNKISSKKILISVGGKPKKLNIPGVDLAWTSDDIFELEKFPKS
ILIVGGGYIACEFASIFRNLGTEVTQLIRGQHLLNGFDEDLSSCLEESPTFTEINIISNT
KLKSIKKVNGNLESTLDSGDKLLTNNILIATGRKPNLLPLNLDFLNLKMDGQYLDVDELN
QTSNANIFAVGDIINKPNLTPVAIEQGRVFSDNFFNDQKRKVNYEYIPKAVFTIPEISTV
GLSEKRAKEIYSEKNIKIFKCKFTPMSNVFRENKSKCMLKIVVHKPTDKVLGCHMFGETS
SEIIQMVSISLNAGITKKDFDITMALHPTISEEFVTMYG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaaaaaatcttggaatttgaatttgacttaattgttgttggcgctggatctgga
ggactcgcggcggctaaacgtgcggctagttatggagcaaaagtcgcaatcatagaagct
aatcaaataggaggaacttgtgtgataaagggatgtgttcctaagaaattaatggtttat
gcagctaaaagtaaaaaaaatatggattattctgaaggatatggattaaaaaatgaaggt
attaattttgaatcaaatattttgttgaagaatattagagaggaggtttctagattaagt
aatttacatagaaattctttaaagaagttgaatatagctatttttgaaggattaggaaga
tttattactcaaaatgaattagaaattatttgttcaaacacaaagaaaattaaaaacaaa
ataagttcaaaaaaaattcttatttcagtaggaggtaaaccaaagaaattaaatattcct
ggggtagatttggcatggactagtgatgatatttttgaattagaaaagtttcccaaatca
atattaatagtaggaggtggatatatagcctgcgaatttgcttctattttcagaaattta
ggtactgaagtaactcaattaattagaggtcaacatttacttaatggttttgatgaggat
ctttcttcatgcctagaggaatcacctacttttactgaaatcaatataatctccaatact
aaattgaaatctatcaagaaagtaaatggaaatctggaatctaccctagactcgggagat
aaactactaactaataatatccttattgctacaggaagaaaaccaaatcttttgccttta
aatttagattttttaaatctaaagatggatggtcaatatttagatgtcgatgaacttaat
caaacaagcaacgcaaatatttttgcagttggcgatatcataaataagccaaacttaact
ccagtagcaatagaacaagggagagttttttcggataatttttttaatgaccaaaaaaga
aaagtaaattatgaatatatccctaaggccgtttttactattccagaaatttcaacagtt
ggcttaagtgagaaaagagctaaagagatttactctgaaaaaaatataaaaattttcaaa
tgcaaatttacccctatgtctaatgtctttagagagaataaatcaaaatgtatgttgaag
attgtagttcataagccaactgacaaagtcctaggatgtcatatgtttggtgaaacatcg
tctgagattattcaaatggtatcaatttcattaaatgcagggataacaaaaaaagacttt
gatattactatggctttgcacccaactatctcggaagaatttgtgactatgtatggataa

DBGET integrated database retrieval system