KEGG   Prochlorococcus marinus MIT 9215: P9215_06541Help
Entry
P9215_06541       CDS       T00598                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00260  Glycine, serine and threonine metabolism
pmh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01130  Biosynthesis of antibiotics
pmh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P9215_06541 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P9215_06541 (trpA)
Enzymes [BR:pmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P9215_06541 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE ThiG PcrB FMN_dh IGPS EHD_N NMO
Motif
Other DBs
NCBI-ProteinID: ABV50269
CyanoBase: P9215_06541
UniProt: A8G3T8
Position
576296..577135
Genome map
AA seq 279 aa AA seqDB search
MKDNKMQITKNEPLSKVDEKFSELKNSKKIALMPFIMAGDPNLEITSEILLKLQENGADL
IELGIPYSDPLADGPVIQVAASRALKSGTSLRKVIKLLESLKGKLNIPIILFSYLNPLLC
FGFEKFCEMASYAGVSGLIVPDLPLEEAYKFSKIVSNQSMDLILLVAPTTPFERMKQISN
HTKGFTYLVSVTGVTGERNKMENRVENLIAKLKEVNSNPIAVGFGISTPEHVVKVREWGA
DGVIIGSAFVKRISSSSEKDVVHHIGEFCKEMRLAADQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacaaaatgcaaattactaaaaatgaacctttatctaaggtagatgaaaag
tttagtgagttaaaaaatagtaaaaaaatagctttgatgccttttataatggctggggat
cccaatcttgaaataacgtctgagatattattaaagttacaagaaaatggagctgacctt
attgaattaggtatcccatatagtgacccacttgcagatggtcctgttattcaagtagcg
gcctctcgagccttaaagtcaggtactagcttaagaaaagtaattaaacttttagagtct
ttaaaaggtaaattaaatattcccatcatccttttttcttacttaaatccattactatgt
tttggctttgaaaagttttgtgagatggcatcttatgctggagtttctggattaatagtt
cctgatctccctttagaggaagcttataaattttcaaaaatagttagtaaccaatctatg
gacttgattttattagtagcaccaactactccttttgaaagaatgaaacaaatatcaaat
catacaaaagggtttacttatttagtaagtgttacgggggtcactggtgagagaaataaa
atggaaaatagagtggaaaatcttatagctaaattaaaagaagtaaatagcaatccaatt
gctgttggttttggaatatccactccagaacatgttgttaaagtgcgcgagtggggagca
gatggagtaattattgggagtgcttttgtaaaacgaatttctagttcaagcgaaaaagat
gtcgtccatcatattggtgaattttgtaaagaaatgcgtttagcagctgatcaaaaataa

DBGET integrated database retrieval system