KEGG   Prochlorococcus marinus MIT 9215: P9215_06721Help
Entry
P9215_06721       CDS       T00598                                 

Gene name
proA
Definition
(GenBank) Gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00330  Arginine and proline metabolism
pmh00332  Carbapenem biosynthesis
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01130  Biosynthesis of antibiotics
pmh01230  Biosynthesis of amino acids
Module
pmh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    P9215_06721 (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    P9215_06721 (proA)
Enzymes [BR:pmh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     P9215_06721 (proA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABV50287
CyanoBase: P9215_06721
UniProt: A8G3V6
Position
595561..596871
Genome map
AA seq 436 aa AA seqDB search
MANIFEVPQPDNDLLEKAEKVRLASIKISQTENKNRIKALNFMADYLEKNSKEILEANNA
DYSSAEKKGISKALLSRLKLSRAKLNAGIEGVRKVGDLADPVNQVQIKKELSKGLILERK
TVPIGVLGIIFESRPDAVMQISSLAIRSGNGVMLKGGSEANLTNTSIVKALQEGLNESGL
DRNAICLLTSRKDSMAMLNLEKYINLIIPRGSNELVKFIQENTRIPVLGHADGICHLFID
IEANLEMALSVALDSKIQYPAACNAIETLLVHKDIAPAFLEKAIPLFNSNDVKLIGDNRS
VELGLKYEASLQDWKTEYLDLILSIKIVNNVEEAITHIQKYSSKHTDGIITENSNTANKF
MNVVDSSGVFHNCSTRFADGFRYGFGAEVGISTQTLPPRGPVGLEGLVTYKYFLKGGGHI
VDDFSSGKAIYTHKDL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatctttgaagttcctcaaccagataatgatcttctagaaaaagctgaaaaa
gtacgtttggcttctatcaaaataagtcagactgaaaataaaaatcgaattaaagcctta
aattttatggctgattatctagaaaaaaattctaaagaaatattagaagctaataatgcg
gattattcaagtgcagaaaaaaaaggcatttctaaggctttactttctagattaaagtta
tcaagagcaaaattaaatgcaggaattgaaggagtaagaaaagttggagacttggcggat
cccgtaaatcaagttcaaataaaaaaagagctttcaaagggattgatcttagaaagaaaa
actgtgccaattggagtcttagggattatttttgaatcaaggccagatgctgtgatgcag
attagttctttagcaataagatcaggaaatggagtaatgctcaaaggtggtagtgaagcc
aatttgacaaatacttcaatagtgaaagcattacaagaaggtttaaatgaatcaggcctt
gatagaaatgcaatatgtttattaacaagcagaaaagatagcatggcgatgttgaatctt
gagaaatatattaatttaataattccaagaggaagtaatgaattagttaaatttattcag
gaaaatacgagaattcctgtgttaggtcatgctgatggaatttgtcatttgtttatagat
attgaggcaaatctagagatggctttatcagtcgctttggacagcaaaattcagtatcct
gcagcatgtaatgctatcgaaactttattagttcacaaagatatcgcaccagctttttta
gaaaaggccatccccttgtttaattcgaatgatgttaaattgattggagacaatagatca
gttgaattagggttaaagtatgaggctagtttacaagattggaaaactgaatatttggat
ttaattttatcgataaaaattgttaataatgttgaggaagcaatcacacatattcaaaaa
tatagttcaaaacatacagatggaataattactgaaaattcaaatactgctaataaattt
atgaatgtggttgatagttcaggtgtttttcataattgctctacgcggttcgcagatggg
tttagatatggattcggagctgaagttggtatatctactcaaactcttccaccaagggga
cctgtaggtctagaaggtttggtaacttataaatattttctaaaaggaggcggtcatata
gttgatgatttttcatcaggaaaggcaatctatacacataaagatctttaa

DBGET integrated database retrieval system