KEGG   Prochlorococcus marinus MIT 9215: P9215_07341Help
Entry
P9215_07341       CDS       T00598                                 

Definition
(GenBank) possible VHS domain
Organism
pmh  Prochlorococcus marinus MIT 9215
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_5 PFEMP
Motif
Other DBs
NCBI-ProteinID: ABV50349
CyanoBase: P9215_07341
UniProt: A8G418
Position
complement(657713..658210)
Genome map
AA seq 165 aa AA seqDB search
MPSNWSKIRDEWLDRTAVAKDDAKWALEALINSEEEFFEIEQKIKNKEDAISQVKFLKKK
VKETISSKEISLDDIALNTSNSNKVQISVPSNLTYLLKVWAAAEGRDLSSVAFQCLETGI
REMKSKGSIPSIAVNRYDSACQKRIALAEVNNLLEKYELAQDEIK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtaattggtcaaaaataagggatgaatggcttgatagaaccgccgttgcgaaa
gatgatgctaaatgggcattggaagctttaattaattcagaagaagaattttttgaaata
gaacaaaaaataaagaataaagaagacgctataagccaagtaaaatttttgaagaaaaag
gttaaagaaactatttcctcaaaagaaatcagtctcgatgatattgcattaaatacttca
aattcaaacaaagtacagatctcagtaccatcaaatcttacttatcttttgaaagtttgg
gccgcagcagaagggagagatctgtcaagtgtggcttttcaatgtttagaaactggtata
agggaaatgaaaagcaaaggttcaataccttcaatagcagtaaatagatatgactcggcc
tgtcaaaagaggattgcactagcagaagtgaataatctattggagaaatacgaattggct
caggatgaaatcaaataa

DBGET integrated database retrieval system