KEGG   Prochlorococcus marinus MIT 9215: P9215_08831Help
Entry
P9215_08831       CDS       T00598                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00330  Arginine and proline metabolism
pmh00332  Carbapenem biosynthesis
pmh01100  Metabolic pathways
pmh01130  Biosynthesis of antibiotics
pmh01230  Biosynthesis of amino acids
Module
pmh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    P9215_08831 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    P9215_08831 (proB)
Enzymes [BR:pmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     P9215_08831 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Picorna_P3A NCD1
Motif
Other DBs
NCBI-ProteinID: ABV50498
CyanoBase: P9215_08831
UniProt: A8G4G7
Position
complement(770262..771344)
Genome map
AA seq 360 aa AA seqDB search
MKTWVIKIGTSILRGTEETSTEEVIETLSRSFTSFLSKGNKIILVTSGAVGLGCQKLNIE
TRPNDLSTLQATAAVGQVNLMSLYDKVFNKLGHNIAQILITKADFNSRKSFNNASKTLKK
LIDLNVIPIVNENDTVANEELKYGDNDTLSALVALAINANKLILLTDIENLYSKDPRNNN
DAQPIKEVHNSELKEIKDKNIKNSNNEWGTGGIATKLISAEIATKGGVEVQLVDGTNKKN
LIEIFNDNKIGTLFYPVEKPIRNKKSWLSHAIQTVGKITLDDGASFAIKRKGASLLAVGV
KDVEGNFTINQAVKIVNTNDKEVAKGLVSISSDKLRSILNNKENNNSSIIVVHRDVLALS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttgggttataaaaattggtactagtattttaagaggaacagaggaaacatct
acagaagaagttattgaaaccctttctagatcctttacaagttttctgtcaaaaggaaac
aaaataattttagtaactagtggagccgttggtttaggctgccaaaaattaaatattgaa
acgagaccaaatgatttaagtacccttcaagctactgctgcagtaggtcaagttaattta
atgtccttatacgataaggtatttaataaattaggtcataatattgctcaaatattaata
actaaagctgatttcaattcaagaaaatcatttaataacgcttctaaaactttaaaaaaa
ttaatcgatttgaatgttattccaatagtaaatgaaaatgatacagtagcaaatgaagag
cttaaatatggagataatgataccctctctgctttagttgccttagctataaatgctaac
aagcttattttattaaccgatattgaaaatctatactcaaaagatccacgtaataataat
gatgcgcaacctattaaagaagttcataatagtgaattaaaagaaattaaagataaaaat
attaaaaactcaaataatgaatggggaacaggaggaattgctacaaaactaatttctgcg
gagatagcaacaaaaggaggagttgaagtccaactagttgatggaactaataaaaaaaac
ttaattgaaatttttaatgataataaaattggaactttattttatccagtagaaaaacct
ataagaaacaaaaaaagttggctttctcatgcaattcaaacagtagggaaaattacttta
gatgatggagcttcttttgctattaaaagaaaaggtgcctcacttttagcggtaggtgtt
aaggatgtagaaggaaactttacgattaatcaggcagttaaaatcgtaaatacaaatgat
aaagaagttgcaaaaggtttagtatcaataagtagcgacaaattaagaagtatcttaaat
aataaagaaaacaacaattcctcgataattgtcgtacacagagatgttcttgctctctct
tag

DBGET integrated database retrieval system