KEGG   Prochlorococcus marinus MIT 9215: P9215_09581Help
Entry
P9215_09581       CDS       T00598                                 

Gene name
ispE
Definition
(GenBank) Putative 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (CMK)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00900  Terpenoid backbone biosynthesis
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P9215_09581 (ispE)
Enzymes [BR:pmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     P9215_09581 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABV50573
CyanoBase: P9215_09581
UniProt: A8G4P2
Position
829888..830823
Genome map
AA seq 311 aa AA seqDB search
MQDLAGKKIIIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLFDYLEFQINNEGLIKLE
SDCTDLSLSSDNLIVKSANLLRKKLNIDCGANIFLRKNIPIGAGLAGGSSNAAATLIGLN
KLWDLNVDQKTLFSLASTLGSDIPFFINGGIQLCFGRGEILEKLDSNFDYGVILLKNPNV
SVSTAETYSKYSNRFCYQYLTNGEMIENIRNNLRDNGLNNLNFDKQHLTIKNDLQLVVEN
DNDSVKEALYLLSKLENCLTFSMSGSGPTCFAIFKDIETAKKELNANSKLFEDKGYDAWV
CTFFEKGITFI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttagctggaaagaaaattattataaaatctcctgccaaaataaatttgcac
cttgaagttattggtaaaagggaggatggattccatgagttagcaatgattatgcaaaat
attgatctttttgattatttagaatttcaaataaataatgaaggtttaattaaacttgaa
tctgattgtactgacttaagcttatcaagtgataacttaattgttaaatcggcaaatcta
ttaaggaaaaaattaaatatagattgcggtgcgaatatatttttaagaaaaaatattcca
attggagcaggattagctggtggatctagtaatgcagcagcaacattaataggtcttaat
aaattatgggatttgaatgtagatcaaaaaactttgttttcattagcatcaactttagga
tctgatattcctttttttataaatggtggtattcaattatgttttggaagaggcgaaatt
ttagagaaattagattcaaactttgattatggtgtaattcttttaaaaaatccaaatgta
tcggtatctactgctgaaacttatagtaaatatagcaacagattttgttatcaatatctt
actaatggagaaatgattgagaacataagaaataatttaagagataatggcttaaataac
ctaaattttgataaacaacatttaactataaaaaatgatttgcagttagttgttgaaaat
gacaatgattctgtaaaagaggcattatatttactttctaaattagagaattgtctgaca
ttttccatgagtggatcaggccctacatgctttgcaatctttaaagatatagagactgct
aaaaaagaattaaatgcaaactctaaattatttgaagataaaggttacgatgcatgggtt
tgcactttctttgaaaagggaataacattcatttaa

DBGET integrated database retrieval system