KEGG   Prochlorococcus marinus MIT 9215: P9215_13461Help
Entry
P9215_13461       CDS       T00598                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00900  Terpenoid backbone biosynthesis
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P9215_13461 (dxr)
Enzymes [BR:pmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     P9215_13461 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABV50961
CyanoBase: P9215_13461
UniProt: A8G5T0
Position
1145285..1146499
Genome map
AA seq 404 aa AA seqDB search
MLGSTGSIGTQTLEIASEQPDKFKAVALSAGRNINLLTEQVKTHKPEVVAIEDENLIEDL
KDNINNLDLDSAPLVLGGKEGLNEAAAWDKADTVVTGIVGCAGLIPTMSAINAGKNIALA
NKETLIAAGPIVIPALKKNNSRLLPADSEHSAIFQCLQGLPNYENADFSTGELPKGLKAI
HLTASGGAFRDWAVEDLKHVTVEDATSHPNWDMGKKITVDSATLMNKGLEVIEAHYLFGT
AYENIQIVIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERIQTNWKRLNLSE
IGQLTFKEPDEFKYPCMGLAYAAGKSSGTMPAVLNAANEMAVEQFLKEKISFQEIPIFIS
KACESHIKNFNLNPALEDILEVDNWARLFVMQEIKKGKKYVSIA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggttctactggttcaattgggactcaaactctcgaaatagctagtgagcagcct
gataagtttaaagccgtagctctttcggcaggaagaaatattaatttattaacggaacaa
gttaaaacacataaaccagaagtagttgcaattgaagatgaaaatcttatagaagattta
aaagataatataaataacctagatttggatagtgctcctttggttttaggcggtaaggag
gggcttaacgaagctgcagcatgggataaggcagatactgtagtaaccgggatagtaggc
tgtgcaggcttaattccaacaatgtcagcaattaatgcggggaaaaatattgcacttgct
aacaaagaaactttaattgcagcagggccaattgttattcctgcattaaagaaaaataat
agtaggcttttacctgccgattcagaacactctgctatatttcaatgtttacaaggatta
cctaattatgaaaatgcagatttttcaacaggagagctacctaagggtttaaaagctata
catttaacagcttctggtggtgctttcagagattgggccgttgaagatttaaagcatgtc
acagtggaagatgcgacttcacatcctaattgggatatgggaaaaaaaataactgtagat
tctgcaactctcatgaataaaggattagaagttatagaagcacattatttatttgggacc
gcttacgaaaatatccaaatagttatccaccctcaaagtattattcattcaatgattgag
atggaagattcatcagtattagctcaattaggttggccagatatgaagctacctatttta
tatgcaatgagttggcctgaaagaattcaaacaaattggaagaggttaaatctaagtgaa
attggacaattgacttttaaagagcctgacgagtttaaatatccatgcatgggattagct
tatgctgcaggaaaatcttctggtactatgcctgcagtcttaaatgctgcgaatgaaatg
gccgttgaacaattccttaaagaaaaaatttcttttcaagaaattccaatatttattagc
aaagcttgtgaatcacatataaagaattttaatttgaatcctgcattagaggatattctt
gaagtggataattgggccagactttttgttatgcaagaaattaaaaaagggaaaaaatac
gtaagtattgcataa

DBGET integrated database retrieval system