KEGG   Prochlorococcus marinus MIT 9215: P9215_14121Help
Entry
P9215_14121       CDS       T00598                                 

Gene name
wcaG
Definition
(GenBank) Nucleoside-diphosphate-sugar epimerase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00520  Amino sugar and nucleotide sugar metabolism
pmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    P9215_14121 (wcaG)
Enzymes [BR:pmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     P9215_14121 (wcaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: ABV51027
CyanoBase: P9215_14121
UniProt: A8G5Z6
Position
complement(1202181..1203158)
Genome map
AA seq 325 aa AA seqDB search
MINLNEFTEFNVINNVVSGGAGFLGSHLIDKLLKNGQNVLCLDNLSSGYSGNIAHLKKNK
KFLFINHDILEPLDSTILIEKIWHLASPASPYHYQNDPIRTTRVNYEGTFNLLNLAKSHN
SKMLFASTSEVYGETTNYLQEEDMPVKLSTFSPRACYSEGKRIAETLINSYREKYNLEIR
IARIFNTYGPRLNINDGRVISNFIKQCLTGDKLTIYGDGRQTRSFCYVSDLIEGLLVLME
SNYNYPINIGNEEEISIIKLADLIKNIINKNVIFEYRKLPLDDPKRRKPCLNRAKKYLNW
SPKVTLIEGLHKTISSYKELLRYKN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaacgaatttacagaatttaatgtaataaataatgttgtttctggcgga
gcaggttttttaggatctcacctaattgataaacttttaaaaaatggacaaaatgtttta
tgccttgataatttatcctctgggtattcaggcaacatcgcacatttaaagaaaaataaa
aaattcttatttattaatcatgatattttagaacctcttgattcaacaatattaattgaa
aagatatggcatttggcttcacctgcctcaccctatcattatcaaaatgatccaataaga
actactagggttaattatgaaggaacttttaacttgctcaatttagctaagtctcataat
tcaaagatgcttttcgcaagtacaagtgaagtttatggggaaacaaccaattatttacaa
gaagaagatatgccagtcaagttatcaacctttagtcctagggcttgttattcagaaggg
aaaagaatagcagaaactcttataaattcttacagagaaaaatataatttggaaattaga
atagcaagaatatttaatacttatggaccaagattaaatattaatgatggaagagttatt
agtaatttcataaaacaatgtttgacgggggataaattaacaatttatggagatggtaga
caaactaggtcattttgctatgtaagtgatttaattgaaggactattagttctaatggaa
tctaattataactacccaattaatattggtaatgaagaagaaatatcaataataaaatta
gctgatttaattaaaaatattattaataagaatgtgatttttgagtatcgaaaattacct
ttagatgaccccaaaagaagaaaaccatgcctcaatagggcaaaaaaatatttgaattgg
agtccaaaagttactttaatagaagggctacacaaaactattagttcttataaagaactc
ttaagatataaaaattga

DBGET integrated database retrieval system