KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0796Help
Entry
PMT9312_0796      CDS       T00297                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00330  Arginine and proline metabolism
pmi00332  Carbapenem biosynthesis
pmi01100  Metabolic pathways
pmi01130  Biosynthesis of antibiotics
pmi01230  Biosynthesis of amino acids
Module
pmi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PMT9312_0796
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PMT9312_0796
Enzymes [BR:pmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PMT9312_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA NCD1
Motif
Other DBs
NCBI-ProteinID: ABB49856
CYORF: PMT9312_0796
UniProt: Q31B89
Position
complement(741934..743016)
Genome map
AA seq 360 aa AA seqDB search
MKTWVIKIGTSILRGTEETSTEEVIETLCRSFTSFLLKGNKLILVTSGAVGLGCQKLNIK
TRPNDLSTLQATAAVGQVNLMSLYDKIFNKLGHNIAQILITKADFNSRESFNNASKTLKK
LIDLNVIPIVNENDTVANEELKYGDNDTLSALVALAINANKLILLTDIENLYSKDPRKNK
DAHPIKEVHNSELKEIKNKNNQNSNNEWGTGGISTKLISAEIATKGGVEVQLVDGTNKKN
LIEIFNDNKIGTLFYPLEKPIGNKKSWLSHAIHTVGKITLDDGAFFAINKKGASLLAVGV
KNVEGNFTVNQAVKIVNTDNKEVAKGLVSISSDNLRSILNNKDNNNSSIIVVHRDVLALS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttgggttataaaaattggtactagtattttaagagggacagaggaaacatct
actgaagaagttattgaaaccctttgtagatcctttacaagttttcttttaaaaggaaac
aaattgattttagtgactagtggagccgttggattaggttgccaaaaattaaatattaaa
actaggccaaatgatttaagtacccttcaagctaccgctgcagtaggtcaagttaattta
atgtctttgtacgataaaatatttaataaattaggtcataatattgctcaaattttaatc
acgaaagctgactttaattcgcgagaatctttcaataacgcttctaaaacattaaaaaaa
ttaatcgatttgaatgttattccaatagtaaatgaaaatgataccgtagcaaatgaggag
cttaaatatggagataatgataccctctctgccttagttgccttagctattaatgctaat
aagcttattttattaaccgacattgaaaatctatattcaaaagatccacgtaagaataaa
gatgcgcatcctattaaagaggttcataatagtgaattaaaagaaattaaaaataaaaac
aatcaaaactcaaataatgaatggggaacaggaggaatttctacaaaactaatttctgca
gaaatagctacaaaagggggagttgaagttcaattagttgatggaacgaataaaaaaaat
ttaattgagatttttaatgataataaaattggaactttattttatccattagaaaaacct
ataggaaacaaaaaaagttggctttctcatgcaattcacacagtaggaaaaatcacttta
gatgatggagctttttttgcaattaacaaaaaaggtgcctcacttttagcggttggtgtt
aaaaatgtagaaggaaactttacggttaatcaagctgttaaaatcgtaaatacagataat
aaagaagttgcaaaaggtttagtatcaataagtagtgacaacttaagaagtatcttaaat
aataaagacaataacaactcctctataattgtcgtacacagagatgttctagctctctct
tag

DBGET integrated database retrieval system