KEGG   Prochlorococcus marinus MIT 9312: PMT9312_1066Help
Entry
PMT9312_1066      CDS       T00297                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00860  Porphyrin and chlorophyll metabolism
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT9312_1066
Enzymes [BR:pmi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMT9312_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_16 AAA_18 Sigma54_activat AAA_29 AAA DUF815 ABC_tran AAA_30 AAA_14 MMR_HSR1 SHS2_FTSA AAA_28 AAA_33 AAA_27
Motif
Other DBs
NCBI-ProteinID: ABB50125
CYORF: PMT9312_1066
UniProt: Q31AH0
Position
complement(976037..977125)
Genome map
AA seq 362 aa AA seqDB search
MTTTKKRRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPA
IDVVKDDPYNSSLIDPDLQSKEVLEKIVQGENLECIQKQVPMVDLPLGATEDRLCGTIDI
EKALSEGVKAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVKTVRDAELRVQVVDQRTSFDDNPDEFSLS
VEKQQDELQQKVIKAQEILNSVQMDDDLRLNISAICGELDVDGLRGDIVTNRSARAIAAF
EGRTEVNEYDIARVISCSLRHRLRKDPLEQVDSGEKVIQAFCKVFELDEKDNLSKFQLSA
EA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgactacaacaaagaaaagaagagtttttccttttacagctgtaattggtcaggaagaa
atgaaattagcactcttgttaaatgttattgatccaagaattggaggagtgatgataatg
ggtgatagagggactggaaagtcaactacaattagagctttagcagatttgttgcccgca
atagacgttgttaaagacgatccatataatagttcgctaattgatcctgatttgcagagt
aaagaagttttagaaaaaattgttcaaggagaaaatctagagtgtattcaaaaacaagta
cctatggtggatttgcctttaggagctactgaggacagactttgtggaaccattgatata
gagaaagctttgagtgaaggcgttaaggcatttgaacctggtttattggcaaaagctaat
agaggtttactttatgttgatgaagtgaatttgcttgatgatcatttagttgatgtactt
ttagattcggctgcttccggatggaatacagttgaaagggagggagtctcagttcgacat
cctgcgaggtttgttctaattggttcaggtaatccagaagaaggggaattaagacctcag
ctattggataggtttggaatgagtgttgaggtcaagacagttagagatgctgaattaaga
gttcaggtagttgatcaaaggacatcttttgatgataatcctgatgagttttcattgagc
gttgagaaacaacaggatgaacttcagcaaaaggttattaaagctcaagaaattttaaat
tctgttcaaatggatgatgatcttagattaaatatttccgcaatctgtggagaacttgat
gttgatggtttgcgtggagatattgttacaaatcgatctgcaagagcaattgcagccttt
gagggtaggactgaagtaaatgaatatgatatagcgagggttatttcatgttcattgaga
catagactaagaaaagatccattagaacaagttgattcaggtgaaaaagttattcaagct
ttttgtaaagtatttgagttagatgaaaaagataatctttctaaatttcaattgtctgca
gaagcctaa

DBGET integrated database retrieval system