KEGG   Prochlorococcus marinus MIT 9312: PMT9312_1098Help
Entry
PMT9312_1098      CDS       T00297                                 

Definition
(GenBank) putative glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00561  Glycerolipid metabolism
pmi00640  Propanoate metabolism
pmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PMT9312_1098
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PMT9312_1098
Enzymes [BR:pmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PMT9312_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase YokU
Motif
Other DBs
NCBI-ProteinID: ABB50157
CYORF: PMT9312_1098
UniProt: Q31AD8
Position
complement(1010190..1011281)
Genome map
AA seq 363 aa AA seqDB search
MQLISPEIVFRGKDAWEKALPQITKLTKSPLILGRGIHTNNLRNKIFNDLKNQNLIVNSA
NLQFDCCYEDISRVKNIILKNNNDSVIAAGGGKVLDSGKYIAECLNIPCITVPLSASTCA
GWTALSNIYTKDGQFIKDVALGSCPRILVYDHKFIQKAPSRTLASGIADALAKWYESSIT
SSTIDDGLVQQAIQISRVLRDQLLIDGEKAFKGQFENNPSWRNTVEACGLTAGLIGGIGG
EKCRTAAAHAIHNAITQIITPNKFLHGEIVGVGLLLQLRLEEIKNNNKLADQSIKQLLVL
MKELKLPTTIAQLGINVFENNNLEKIADFTCRDKSEIHFLPFEIFKQDIIEVITNFEQQK
IKI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatttctccagaaattgtatttagggggaaagatgcttgggaaaaagcttta
cctcaaattactaaattaaccaaaagtccattaattttaggtagggggattcatacaaat
aatctgagaaataaaatatttaatgatttaaaaaatcaaaaccttattgttaattctgct
aatttacaatttgattgttgttatgaagacatttcaagagtaaagaatatcattttaaag
aataataatgattctgttatcgctgctggaggtggcaaggttctagattctgggaaatat
atagcagagtgtcttaatatcccttgtattacagtgcctcttagcgcctctacatgtgca
ggttggacagccttatcgaatatttatacaaaagatggccaattcataaaggatgttgca
ttaggatcttgtccaagaatcctagtatatgatcataaatttattcaaaaagccccatct
agaacacttgctagtggcatagctgatgctttggcaaaatggtatgaatcctcaataaca
agttcaacaatagatgatggacttgttcaacaagcgattcagatatcaagagttttaaga
gatcaactattaatagatggagaaaaagcttttaaaggacaattcgaaaataatccttct
tggcgaaatactgtagaagcttgtggacttacagcaggattaatcggaggtattggtgga
gaaaagtgtaggactgccgcagcacatgctattcataatgcaattactcagataattacc
cctaataaattcttacatggtgagattgttggagtaggattattattgcaattaagacta
gaagaaattaaaaataataataaattagctgatcaatcgattaaacaattattggtactc
atgaaagaattgaaattaccaactactattgcacaacttggaataaatgtttttgaaaat
aataatttagagaaaattgctgattttacttgtcgagataaatctgagattcattttttg
ccttttgaaatttttaaacaggacataatagaggtcattacaaattttgaacaacaaaaa
attaaaatataa

DBGET integrated database retrieval system