KEGG   Prochlorococcus marinus MIT 9312: PMT9312_1393Help
Entry
PMT9312_1393      CDS       T00297                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
pmi01130  Biosynthesis of antibiotics
pmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMT9312_1393
Enzymes [BR:pmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PMT9312_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABB50453
CYORF: PMT9312_1393
UniProt: Q319J2
Position
complement(1307071..1307958)
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPTVRVENLEYAVPHREAQAKNILEEIVWHKDIEIKNFKKIVSLEDLIKKIE
NLPDPKDFYKNILESKIKPGLIAEIKKASPSKGVIRKDFNPEDIAICYEELGASCISVLT
DKRFFQGSYEILETVRKSTNLPLLCKDFIISAYQIYKARVSGADAILLIAAILSDDDLIY
LKKIADNLKMSVLVEVHNDNELERILKLKSFNLIGINNRDLKTFKTDLKTSIELMHIYAD
IFLKQNILPISESGINCAQDLESLRSIGIKGVLIGETFMRESDIEKSFKKLFNSI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagataagacgcaggccaccaaatccaacagtaagggtagaaaatttagaatatgcc
gtgcctcatagagaagcacaagcaaaaaatattctagaagaaattgtatggcacaaggat
attgaaattaagaattttaaaaaaatagtttctttagaagatctcatcaaaaagattgaa
aaccttccagatcccaaagatttttataaaaatatcttggagtcaaaaataaaaccagga
ttaattgctgaaataaaaaaagctagtccgagtaaaggagttattagaaaagattttaac
cctgaagacatagcaatttgttatgaagaattaggagcatcatgtatctcagtacttacc
gataaaaggttttttcaaggtagttatgaaatactcgaaactgtaaggaaatcaactaat
ctccctctactctgcaaagattttattatttctgcttatcagatttataaagcaagggta
tctggtgctgatgcaatattattaatcgctgcgattttaagtgatgacgatttaatttat
ctaaagaaaatagctgataatttaaagatgagcgttcttgttgaagtccataacgataat
gaattagaaaggatactaaagttaaaatcttttaatttgattggaataaataatagggac
ttaaagacttttaaaacggatttaaaaacatcgatagaattgatgcatatatatgcagat
atatttttaaaacaaaatattcttcccattagtgaatctggaattaattgtgcccaagac
ttagaatcgcttagatctattgggatcaagggagtattaattggtgaaacttttatgaga
gaaagtgatattgaaaaatctttcaagaaattatttaattcaatttaa

DBGET integrated database retrieval system