KEGG   Proteus mirabilis BB2000: BB2000_0500Help
Entry
BB2000_0500       CDS       T02789                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00330  Arginine and proline metabolism
pmib00332  Carbapenem biosynthesis
pmib01100  Metabolic pathways
pmib01130  Biosynthesis of antibiotics
pmib01230  Biosynthesis of amino acids
Module
pmib_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmib00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BB2000_0500 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BB2000_0500 (proB)
Enzymes [BR:pmib01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BB2000_0500 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGS59015
Position
584752..585894
Genome map
AA seq 380 aa AA seqDB search
MYDLLNQQKMVNVMSSSQTLVVKLGTSVLTGGSRRLDQSHIVELVRQCAKQHEKGHRIII
VTSGAIAAGREYLNYPDLPATIASKQLLAAVGQSALIQVWKQLFAIYGIHIGQMLLTRAD
IEDRERFLNARDTLHALLDNKIIPVINENDAVATAEIKVGDNDNLSALAAILGGADKLLL
LTDIEGLYTADPRSNPDAKLIPEVFDINDELRQMAGDSVSGLGTGGMATKLQAATVAGRA
GIDVVIAAGVKPDVISKVIDNEPVGTLFHGLKSPLETRKRWIFGAPVAGVIIVDNGAEKA
IKEQGSSLLPKGIKEIKGDFSRGCVIRIQSLQGKDLAHGVAHYNSDALRLIAGHHSQEIS
QILGYEYGSVAVHRDDMIVS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgatcttttaaatcaacaaaaaatggtaaatgttatgagtagcagccaaacgctg
gttgttaaattagggacaagtgtactgactggtggttcacgacgtctggatcagtctcat
attgtagagctggttcgccaatgtgcaaaacaacacgaaaaagggcaccggataattatt
gtcacgtcgggagcaatagcggcagggcgtgaatatttaaactaccccgatttgcccgca
acaatagcatctaaacaactgttagccgctgtggggcaaagtgctttaattcaggtatgg
aaacagctatttgctatttatggtattcatattgggcaaatgttattaactcgcgcggat
atagaagatagagaacgttttttgaatgcgcgtgatacactgcatgcattattagataac
aagattattcctgttatcaatgaaaacgatgccgttgctactgcagaaataaaagtaggg
gataacgacaatctttcggcattagctgccattttaggtggcgctgataaactcctgtta
cttactgatatcgaaggtctatatacggccgatcctcgtagcaatccggatgcgaagctt
attccagaagtttttgatatcaacgatgaattacgtcaaatggccggtgatagtgtctct
ggtttaggtactggaggtatggcaactaagttacaagcggccactgttgcagggcgtgct
ggtattgacgttgttattgccgccggtgttaagcctgatgttatcagtaaagttattgat
aatgaacctgtcggaacactctttcatggtttaaaaagcccccttgaaacgcgtaaacga
tggatttttggtgctccagtcgcaggggttatcattgttgataatggggctgaaaaagcg
attaaagagcagggtagttctcttttacctaaaggtattaaagaaattaaaggtgacttt
tctcgagggtgtgttatccgcattcaaagtttgcaaggaaaagatcttgctcatggtgtc
gcgcattataatagtgatgcgctacgcttaattgcggggcaccattcgcaagagattagt
caaattttaggctatgagtatggcagtgttgcggttcaccgtgatgatatgattgtgagc
tag

DBGET integrated database retrieval system