KEGG   Proteus mirabilis BB2000: BB2000_0809Help
Entry
BB2000_0809       CDS       T02789                                 

Gene name
tssM
Definition
(GenBank) TssM
  KO
K11910  type VI secretion system protein VasJ
Organism
pmib  Proteus mirabilis BB2000
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmib02044]
    BB2000_0809 (tssM)
Secretion system [BR:pmib02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BB2000_0809 (tssM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N Helicase_C_3
Motif
Other DBs
NCBI-ProteinID: AGS59305
Position
complement(923822..925285)
Genome map
AA seq 487 aa AA seqDB search
MMNNTSYAWKQQLLTALDEQQVSSAVNDNDADWEYIDSEMIKFGSLSHGQLDIKEIQRRC
LHLFETQTKDFRILVHLLRTLQHAGEPKELVLAAQILTDFNRQYWQSCYPTNMKLKSRLA
NQVLKRFETASESFCHAANSAMRDDILGSFAFLAQFWHEQSPALAEQIDDLSRDYNRIEN
NDAPIIVASPAEKEEKVQTPPVSESIETPTKNSLTPTINVNHQDERQWKQTLLQVADVIC
QQAPESSVGYRIRRYAIWHAITVLPQANAQGKTPLAPVSIDRVMDYKAQLTQASITLLNN
IEQSLSLSPYWLEGHMLAAQVAAKLGYGEVESGIIEELRIFLARLPELVNLHFSDMTPFF
PESVQQWLEQYNQTENGQLPPSNTNTAILEQEVLQCYEQQGLEAALKLIELNLASRSEPR
DRFYGQLLSAQLFELSGMDYMATQLYQQLNTSASHYSLADWEPNLIRQLMQKIDKKTEIT
MTMDRDQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaatacttcttatgcatggaaacaacagctactgacagcacttgatgaacag
caagtcagtagtgctgtcaatgataatgatgccgactgggaatatattgacagtgaaatg
ataaagttcggctcacttagtcatggtcaattagatattaaagagatccagcgtcgctgt
ttacacctatttgaaacgcagactaaagattttcggatcttagtccatttattacgtact
ttacagcatgctggagagccaaaagaattagtattggcagcacagatcctaactgatttt
aatcgtcaatattggcaaagttgctacccaaccaatatgaaattgaaatcacgtttagcc
aatcaagttttgaaacggtttgaaacagcgagtgagagtttttgtcatgcagccaatagt
gcgatgcgtgatgatattctaggctcgttcgcctttctagcgcaattttggcatgaacaa
agcccggcacttgcagaacaaattgatgatttaagcagagattataatcgtattgaaaat
aacgatgcgccgattattgttgcttcacctgccgagaaagaagaaaaagtacagactccg
ccggttagcgagtctatagaaacaccgacaaaaaatagcttaacaccaactattaacgtt
aaccatcaagatgaaagacaatggaaacaaacattacttcaagtagctgatgttatctgc
caacaagcccctgaaagttcagtaggatatcgtatacggcgttatgcaatttggcacgct
attacggtcttacctcaagctaatgctcaaggtaaaacgcctttagcccccgtatcaatt
gaccgtgtaatggattacaaagctcaactgactcaagcgtccattacgctattaaacaat
attgaacagagtctctcactctctccttactggttagaaggccatatgttagctgcacaa
gtagcagctaaattaggttatggagaagtagaaagtggcattattgaagagttacgtatt
tttttagcgcgtcttcctgaacttgttaacttgcacttttcggatatgactcccttcttt
cctgaaagtgtacaacagtggttagagcaatataaccaaactgaaaacggtcaattgcca
ccatcgaatacaaatactgcgatcctagagcaagaagtcttgcaatgttatgaacaacaa
ggtcttgaagcagccctgaagcttattgaattaaaccttgctagcagatcagagcctaga
gatagattttatggacaattattgtctgcacaactatttgaattgtcaggtatggattat
atggctacacagttataccaacaacttaatacctctgcctcacattattcacttgcagat
tgggaacccaacttaatacgacaactcatgcaaaaaatagacaaaaagacagaaataaca
atgactatggatagggatcaataa

DBGET integrated database retrieval system