KEGG   Proteus mirabilis BB2000: BB2000_0821
Entry
BB2000_0821       CDS       T02789                                 

Gene name
tssA
Definition
(GenBank) TssA
  KO
K11901  type VI secretion system protein ImpB
Organism
pmib  Proteus mirabilis BB2000
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmib02044]
    BB2000_0821 (tssA)
Secretion system [BR:pmib02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BB2000_0821 (tssA)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AGS59317
Position
complement(938109..938609)
AA seq 166 aa
MSKKNLGSVAPKERINIKYTPNTGGAQAEVELPLNMLIVGDMKGKTEETPIEDRKAISVN
QNNFNSVMESAGINLNINVRNTLEESSDSELNVNLDVKSLQDFSPDSIARQVPELNKLLE
LREALVALKGPLGNVPAFRKRLQELLENQETREQLLKELDIAANQK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagtaagaaaaatctcggtagtgttgcccctaaagaaaggattaatattaaatatacg
ccaaatactggcggagctcaggctgaagtcgaacttccattgaatatgttgattgttggg
gatatgaaaggtaaaacggaagagacccccattgaagatcgcaaagcgatttcagtcaat
caaaacaacttcaattctgttatggaaagtgctggcattaatttaaatattaatgttcgc
aataccttagaagaaagcagtgattcagagcttaatgttaaccttgatgtgaaatcttta
caggatttctctcctgatagtatcgctcgccaagtgcccgaattaaataaacttctcgaa
ttgcgtgaagctttagttgcattaaaaggtcctctaggcaatgtcccagcttttagaaag
cgtcttcaagaactacttgaaaatcaagaaactcgcgaacagcttctaaaagagctcgat
attgctgctaatcaaaaataa

DBGET integrated database retrieval system