KEGG   Proteus mirabilis BB2000: BB2000_1878Help
Entry
BB2000_1878       CDS       T02789                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00430  Taurine and hypotaurine metabolism
pmib00620  Pyruvate metabolism
pmib00640  Propanoate metabolism
pmib00680  Methane metabolism
pmib01100  Metabolic pathways
pmib01120  Microbial metabolism in diverse environments
pmib01200  Carbon metabolism
Module
pmib_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB2000_1878 (ackA)
   00640 Propanoate metabolism
    BB2000_1878 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BB2000_1878 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BB2000_1878 (ackA)
Enzymes [BR:pmib01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BB2000_1878 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AGS60353
Position
2024180..2025382
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIINPENGEEFLSGLAECFNLPEARLKWKMDGQKHEAALGAG
AAHSEALNFIVNTILAEKPELSQQIAAIGHRIVHGGEKFTKSVVITDEVIKGIEAAIPFA
PLHNPAHLIGIEEARKAFPHLINKMVAVFDTAFHQTMPEEAYLYALPYSLYKDHSIRRYG
AHGTSHFFVSREAAKMLNKPVDELNVITCHLGNGGSVSAIVNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIVFHLHDTLGMSVEDINKLLTKESGLLGLTEVTSDCRYVEDNYETKADAK
RAMDVYCHRLAKYIGSYCALMEGRLDAIIFTGGIGENAAMVRELSLKKLALLGFEVDHQR
NLDARFGKSGTITTDNSRLAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaagctggtgctggtactgaactgcggtagttcttctcttaagtttgcaatt
attaacccagaaaatggtgaagaattcctttcaggcttggctgagtgcttcaaccttcct
gaagcccgcctgaagtggaaaatggatggtcagaaacatgaagcggctttaggcgctggt
gctgcccacagcgaagcattaaactttattgttaatactattctggctgagaaaccagaa
ctttcacaacaaatcgcagcaattggtcatcgtattgttcacggtggcgagaaatttact
aaatctgtcgtcattactgacgaagtcatcaaaggtattgaggcggctattccatttgcc
ccattacataacccagctcaccttattggtattgaagaagcgcgtaaagccttccctcat
ttaattaataaaatggtggcagtatttgacactgcattccaccaaacaatgccagaagaa
gcttatctgtatgctctgccatacagcttatataaagatcacagcatccgccgttacggt
gctcacggaactagccatttctttgtttcccgtgaagcagctaaaatgttaaataaacct
gttgatgaactgaacgtaatcacttgccatttaggtaatggtggttctgtttctgctatt
gttaacggtaaatgtgttgatacttctatgggtttaacaccattagaaggtttagtcatg
ggtactcgtagtggtgatatcgatcctgctatcgtgttccatttacatgatactttaggt
atgagcgttgaagatattaataaactgctcactaaagaatctggtttattaggtttaacg
gaagttactagtgactgccgttatgttgaagataactacgaaacaaaagctgatgctaaa
cgtgcaatggacgtttactgccatcgcttagcgaaatacatcggttcttattgtgcactg
atggaaggtcgtttagatgccattatcttcactggtggtatcggtgaaaatgcagcaatg
gttcgtgaattatcactgaaaaaactcgctctattaggttttgaagttgatcatcagcgt
aacttagatgcacgtttcggtaaatcaggcaccatcactaccgataacagccgtcttgct
gttgttatcccaactaacgaagagttagttatcgctcaggatgctagccgcctgaccgct
taa

DBGET integrated database retrieval system